Recombinant Human Serine/arginine-rich splicing factor 3 (SRSF3), partial

In Stock
Code CSB-EP021155HU1
Abbreviation Recombinant Human SRSF3 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
SRSF3
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Pre-mRNA-splicing factor SRP20;Splicing factor, arginine/serine-rich 3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-86aa
Target Protein Sequence
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.9 kDa
Protein Length
partial
Tag Info
N-terminal 6xHis-GB1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant Human SRSF3 protein in e.coli cells is a multi-step process, including constructing the expression vector coding for the Human SRSF3 protein (1-86aa), transforming the recombinant vector into e.coli cells, selecting the cells that containing the vector and cultivating them, performing cell lysis, collecting the protein, and characterizing the protein. The resulting recombinant Human SRSF3 protein is purified from the cell lysate through affinity purification, and its purity, determined by SDS-PAGE, is greater than 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Splicing factor that specifically promotes exon-inclusion during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, promotes recruitment of SRSF3 to its mRNA-binding elements adjacent to m6A sites, leading to exon-inclusion during alternative splicing. Also functions as export adapter involved in mRNA nuclear export. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NXF1 pathway); enhances NXF1-NXT1 RNA-binding activity. Involved in nuclear export of m6A-containing mRNAs via interaction with YTHDC1: interaction with YTHDC1 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export. RNA-binding is semi-sequence specific.
Gene References into Functions
  1. Results show that SRSF3 impairs the autoregulation mechanism of SRSF5 and promotes the overexpression of SRSF5 in oral squamous cell carcinoma. PMID: 29857020
  2. TDP43 alters most splicing events with splicing factor SRSF3 in triple-negative breast cancer. PMID: 29581274
  3. Loss of SRSF3 expression was significantly associated with poor survival and shorter disease-free survival, particularly in early stages, in colorectal cancer. PMID: 29131639
  4. Findings reveal the molecular mechanism of SRSF3 in pri-miRNA processing and support the previously proposed explanation for the highly conserved position of CNNC in SRSF3-enhanced pri-miRNA processing. PMID: 29615481
  5. High expression of SRSF3 is associated with oral squamous cell carcinoma. PMID: 27808105
  6. MicroRNA-1908-5p contributes to the oncogenic function of the splicing factor SRSF3 via NKIRAS2 axis in osteosarcoma cells. PMID: 28039456
  7. Dehydroepiandrosterone (DHEA) and cortisol modulate SRSF9 and SRSF3 in a different way and data suggest that the anti-glucocorticoid effect of DHEA, among other mechanisms, is also exerted by modulating the expression of proteins involved in the splicing of the GR pre-mRNA. PMID: 28373129
  8. that SRSF3 controls the expression of the miR-132/212 cluster through regulating REST expression PMID: 28624413
  9. Alternative splicing of U2AF1 reveals a shared repression mechanism for duplicated exons controlled by SRF3. PMID: 27566151
  10. Introduction of point mutations in the SRSF3-binding site or knockdown of SRSF3 expression in cells reduces human papillomavirus 18 929;3434 splicing and E1;E4 production but activates other, minor 929;3465 and 929;3506 splicing. Knockdown of SRSF3 expression also enhances the expression of E2 and L1 mRNAs. PMID: 27489271
  11. data indicate that the Human Papillomavirus E2 protein links the viral replication cycle to epithelial differentiation via SRSF3, a key cellular regulator of high-risk (HR)-HPV gene expression PMID: 26962216
  12. Results suggested that SRSF3 is associated with the initiation and development of OSCC and may be a biomarker and therapeutic target of OSCC. PMID: 27429590
  13. we also demonstrated frequent co-overexpression and positive correlation of DARPP-32, SRp20 and CD44E expression levels in human gastric primary tumors. PMID: 26119931
  14. Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding. PMID: 26876937
  15. These data indicate that SRSF3 affects a global change of gene expression to maintain cell homeostasis. PMID: 26704980
  16. We propose that SRSF3 could act as a coordinator of the expression of PDCD4 protein via two mechanisms on two alternatively spliced mRNA isoforms. PMID: 26773498
  17. This new function of SRSF3 not only explains why overexpression of SRSF3 is required for ovarian cancer cell growth and survival but also offers a new insight into the mechanism of the neoplastic transformation. PMID: 26282282
  18. SRSF3 and hnRNP H1 are the first splicing factors identified which regulate the production of these functionally distinct HER2 splice variants and therefore maybe important for the regulation of HER2 signaling. PMID: 26367347
  19. expression either decreased or the protein mislocalized in hepatocellular carcinoma PMID: 25132062
  20. Results identified modulation of SRSF3 activity as the molecular mechanism by which ORF57 promotes RNA splicing. PMID: 25234929
  21. Data suggest that the oncogenic potential of SRSF3 might be realized, in part, through the translational repression of PDCD4 mRNA. PMID: 24292556
  22. Stress-inducible truncated SRSF3 may participate in the acceleration of cell growth through facilitating c-Jun-mediated G1 progression under stressful conditions. PMID: 24190040
  23. This is the first study that demonstrates that rs1122608 confers protection against ischemic stroke and implicates splicing factor SFSR3 in the disease process PMID: 24190014
  24. findings disclose an important role of SRSF3 in the regulation of the G1-to-S-phase progression and alternative splicing of HIPK2 in tumor growth PMID: 23503458
  25. truncated SRSF3 protein may function as a positive regulator of oxidative stress-initiated inflammatory responses in colon cancer cells. PMID: 24284797
  26. Therefore we conclude that SRSF3 promotes exon 9 skipping of caspase-2 pre-mRNA by interacting with exon 8 PMID: 24321384
  27. Work described here examined the punctate pattern of SRp20 localization in the cytoplasm of poliovirus-infected cells, demonstrating the partial co-localization of SRp20 with the stress granule marker protein TIA-1. PMID: 23830997
  28. Digoxin-mediated repression of SRSF3 expression plays a role in the digoxin-mediated inclusion of exon 20 in the IKBKAP transcript generated from the familial dysautonomia mutant allele. PMID: 23711097
  29. downregulation of SRSF3 represents an endogenous mechanism for cellular senescence that directly regulates the TP53 alternative splicing to generate p53beta PMID: 22777358
  30. results further define the mechanism of SRp20 cellular redistribution during picornavirus infections PMID: 23255796
  31. Serine arginine splicing factor 3 is involved in enhanced splicing of glucose-6-phosphate dehydrogenase RNA in response to nutrients and hormones in liver PMID: 23233666
  32. This study does not confirm a role for genetic variants in the SFRS3 and FKBP4 genes in the pathogenesis of corticosteroid-induced ocular hypertension. PMID: 22921020
  33. This study found that significant changes in serine/arginine protein 20 (Srp20) gene expression in AD cases and confirmed this using a second cohort of control/AD. PMID: 22788679
  34. Protein extracts of colon cancer CD133+ cell stem cells were compared to protein extracts of colon cancer cell CD133- stem cells by 2D DIGE. Demonstrated a direct cause-effect relationship between Wnt pathway activation & increased SRp20 expression. PMID: 22623141
  35. Relative levels of SRp20, SRp30c, and SRp40 in TM cells control differential expression of the two alternatively spliced isoforms of the GR and thereby regulate GC responsiveness. PMID: 22205602
  36. a model in which SRp20 interacts with PCBP2 bound to the viral RNA, and this interaction functions to recruit ribosomes to the viral RNA in a direct or indirect manner, with the participation of additional protein-protein or protein-RNA interactions. PMID: 21779168
  37. Silencing of SFRS3 increased IL-1beta secretion due to elevation of IL-1beta and caspase-1 mRNA in addition to active caspase-1 levels. PMID: 21611201
  38. expression of PTB and SRp20 is associated with malignancy of ovarian tumors but not with stage of invasive epithelial ovarian cancer PMID: 20856201
  39. Results suggest that increased SRp20 expression in tumor cells is a critical step for tumor initiation, progression, and maintenance. PMID: 21179588
  40. Epstein-Barr Virus SM protein utilizes cellular splicing factor SRp20 to mediate alternative splicing. PMID: 20810723
  41. The authors report that siRNA knockdown of SRp20 or 9G8 resulted in about a 10 fold decrease in herpes simplex virus 1 yields and in nuclear accumulation of polyA+ RNA. PMID: 20227104
  42. insulin induces the proteasome-dependent degradation of SRp20 as well as the subnuclear relocalization of CLIC1 PMID: 15827065
  43. These results suggest that the C-terminal domain of RPB1 promotes exon skipping by recruiting SRp20 and that this contributes independently of elongation to the transcriptional control of alternative splicing. PMID: 17028590
  44. nucleo-cytoplasmic SR protein, SRp20, functions in internal ribosome entry site (IRES)-mediated translation of a viral RNA. PMID: 17183366
  45. abundant SRp20 in cancer cells or undifferentiated keratinocytes is important for the expression of the viral early E6 and E7 by promoting the expression of cellular transcription factor SP1 for transactivation of viral early promoters. PMID: 18945760
  46. Study reports the splicing factor SRp20 as a novel target gene of beta-catenin/TCF4 signaling. PMID: 18952824
  47. SRp20, SF2/ASF, and CUG-BP1 act antagonistically to regulate IR alternative splicing in vivo and that the relative ratios of SRp20 and SF2/ASF to CUG-BP1 in different cells determine the degree of exon inclusion. PMID: 19047369
  48. SRp20 associate with interphase chromatin, and is released from hyperphosphorylated mitotic chromosomes PMID: 19250906

Show More

Hide All

Subcellular Location
Nucleus. Nucleus speckle. Cytoplasm.
Protein Families
Splicing factor SR family
Database Links

HGNC: 10785

OMIM: 603364

KEGG: hsa:6428

STRING: 9606.ENSP00000362820

UniGene: Hs.405144

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*