Recombinant Human Sex hormone-binding globulin (SHBG)

Code CSB-YP021252HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP021252HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP021252HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP021252HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP021252HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
SHBG
Uniprot No.
Alternative Names
Sex hormone-binding globulin; SHBG; Sex steroid-binding protein; SBP; Testis-specific androgen-binding protein; ABP; Testosterone-estradiol-binding globulin; TeBG; Testosterone-estrogen-binding globulin; SHBG
Species
Homo sapiens (Human)
Expression Region
30-402
Target Protein Sequence
LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.
Gene References into Functions
  1. SHBG suppresses inflammation and lipid accumulation in macrophages and adipocytes, which might be among the mechanisms underlying the protective effect of SHBG, that is, its actions which reduce the incidence of metabolic syndrome PMID: 30046278
  2. SHBG served as a major predictor for the risk of MetS and was correlated with serum adiponectin and leptin levels that are independent of T. PMID: 28577342
  3. Low SHBG expression not only participates in the development of local insulin resistance, but may also play an important role in PI3K/AKT pathway-mediated systemic insulin resistance and gestational diabetes. PMID: 29298529
  4. Fibulin-1 is expressed in breast cancer cell lines, interacts wtih SHBG, and is increased by estradiol PMID: 29940241
  5. These data, therefore, reflected that SHBG single nucleotide polymorphism rs6259 causes changes in placental SHBG concentration and may play a functional role in the molecular mechanisms of the gestational diabetes mellitus etiology. PMID: 29484425
  6. This is the first study that provides detailed analyses of SHBG with metabolic syndrome components in male diabetic subjects. PMID: 29245159
  7. in postmenopausal women, aromatase activity could be an important determinant of skeletal health. PMID: 29329467
  8. Consumption of high coffee and caffeine is associated with a reduced risk of low SHBG, an established risk marker for T2DM, which might contribute to the protective effects of coffee for type 2 diabetes. PMID: 28664630
  9. Circulating sex steroids, prolactin, insulin-like growth factor (IGF) I, IGF-binding protein 3, and sex hormone-binding globulin (SHBG) were evaluated using backward elimination separately in women pre- and postmenopausal at blood collection. PMID: 28246273
  10. Patient-associated features such as body mass index and serum levels of Testosterone and SHBG can improve the predictive capability of consolidate tumor-specific biomarkers in both pre- and postmenopause. PMID: 29474646
  11. relationship of testosterone, sex hormone-binding globulin (SHBG), and IGF-1 with bone mineral density (BMD) and bone turnover markers (BTMs) in Korean men, is reported. PMID: 27873076
  12. SHBG increased total androgen and estrogen concentrations via hypothalamic-pituitary feedback regulation and prolonged ligand half-life. PMID: 27748448
  13. low serum SHBG is associated with insulin resistance in men with nonalcoholic fatty liver disease. PMID: 28282659
  14. no association was seen between the stuttering and digit ratio, progesterone, or SHBG PMID: 28992603
  15. there is limited clinical utility of serum Estradiol, Testosterone, and SHBG measures for the evaluation of osteoporosis risk in elderly men. PMID: 27753150
  16. endogenous steroid hormone, sex hormone-binding globulin, and precursor steroids are associated with hemostatic factors in postmenopausal women PMID: 27797446
  17. cross-sectional associations between individual bioavailable sex hormones and SHBG with radiographically assessed kyphosis, were examined. PMID: 27355438
  18. Temporal change in serum SHBG, but not Testosterone, Estradiol, or other hormonal variables, was significantly associated with any, nonvertebral or hip fracture incidence in univariable analyses. PMID: 27363725
  19. In vitro androgen bioactivity reflects the inhibitory effects of SHBG. PMID: 27576188
  20. In men with hepatic steatosis, we found that elevated serum ALT levels were associated with lower serum SHBG levels. PMID: 28540984
  21. In the total population adjusting for race/ethnicity, there was no association between SHBG and fracture in women. The interaction between race/ethnicity and SHBG was also not statistically significant. PMID: 28324031
  22. Depression and anxiety in subfertile males are associated with lower secretion of SHBG. PMID: 28456148
  23. UBQLN4, APP, CTNNB1, SHBG, and COL1A1 might be involved in the development of nonalcoholic fatty liver disease, and are proposed as the potential markers for predicting the development of this condition PMID: 28796060
  24. Male infertility is associated with GA genotype and A allele of rs6259 locus, as well as CC genotype of rs727428 locus in SHBG gene PMID: 28796064
  25. Low serum SHBG was the most relevant factor for prediabetes and diabetes PMID: 27583401
  26. two non-linked SNPs (rs6259 and rs9901675) at the SHBG gene locus might be of importance for language impairment problems in boys. PMID: 26930261
  27. Data suggest there is a strong inverse correlation between SHBG (sex hormone-binding globulin) and DHEA (dehydroepiandrosterone) levels in cord blood obtained at birth from infants of both sexes; there are no associations between SHBG and testosterone or DHT (dihydrotestosterone) levels. This study was conducted in Sweden. PMID: 28373106
  28. modulates hepatic lipogenesis; reduction of SHBG plasma levels in obese and type 2 diabetic subjects could be directly associated with nonalcoholic fatty liver disease development through an increase in hepatic lipogenesis PMID: 28359088
  29. Short-term weight reduction program (WRP) has the potential effects of lowering body weight, mass index, body fat percentage, and fat weight and increasing serum HDL-C levels and insulin sensitivity in obese children. Although serum SHBG levels moderately increased in both sexes during short-term WRP, change in SHBG concentrations might be a potential biomarker to evaluate improvement in insulin resistance in girls only. PMID: 28489766
  30. SHBG was inversely associated with the risk of type 2 diabetes in women. [Meta-Analysis] PMID: 28223343
  31. Osteocalcin and Sex Hormone Binding Globulin Compete on a Specific Binding Site of GPRC6A. PMID: 27673554
  32. Low sex hormone-binding globulin (SHBG) in conjunction with high estradiol has an additive detrimental effect on the risk of type 2 diabetes (T2D) in men. PMID: 26119029
  33. we genotyped five hormone-related genes: estrogen receptor-alpha (ESR1), aromatase (CYP19), catechol-O-methyl transferase (COMT), sex hormone-binding globulin (SHBG)and glutathione S-transferase (GSTP1). Our data demonstrate that these ESR1, GSTP1, and CYP19 polymorphisms are associated with risk of BC, and the risk haplotype TGGGGTC could help to identify populations with high susceptibility to BC in Chinese women. PMID: 27323034
  34. cortisol/testosterone and cortisol/sex hormone-binding globulin ratios are useful biomarkers for atherosclerosis in middle-age women PMID: 27031578
  35. Data show that low that low globulin (GLB) levels were significantly associated with favorable survival, and low ALB levels were associated with a significantly worse survival PMID: 26476541
  36. Sex hormone-binding globulin has no effect on salivary testosterone. PMID: 27117450
  37. In hormonal contraceptive users, SHBG was positively associated with both activated protein C (APC) resistance and baseline TG, and protein S and prothrombin were important mediators. These data provide further evidence that SHBG may be used as a biomarker in assessing prothrombotic profile of hormonal contraception. PMID: 27323874
  38. No significant differences were observed in serum ABP levels in all male farmers between the two groups with different fluoride exposure. These results supported that excess fluoride exposure decreased serum T levels of male farmers with age-specificity. PMID: 27154732
  39. results indicated that there was a significant association between migraine and gene-gene interaction among the CYP19A1, FSHR, ESR1 and NRIP1. PMID: 27019440
  40. Polymorphisms of SHBG or the neighboring genes were associated with SHBG levels or BMD and osteoporosis PMID: 26657339
  41. high SHBG predicts incident clinical and radiographic vertebral fractures in elderly men. PMID: 26391196
  42. After early childhood, serum sex hormone-binding globulin declines to a nadir in males at the age of 20 years and remains stable till the sixth decade with a gradual, progressive rise thereafter. In females, the sex hormone-binding globulin nadir is reached earlier with levels rising gradually and progressively with age thereafter and accelerating after the age of 70 years PMID: 26438522
  43. higher SHBG (but not testosterone or estradiol) is an independent risk factor for vertebral fractures in older men. PMID: 26778261
  44. We found that elevated levels of estradiol and SHBG in HT [Hormone therapy] users were associated with elevated levels of CRP and lower levels of TFPI, both of which may be related to a prothrombotic milieu in HT [Hormone therapy ]users. PMID: 26700933
  45. There was a drop in SHBG levels in the first week of smoking cessation and levels continued to remain low. PMID: 26680482
  46. SHBG was higher in both obese and non-obese PCOS patients compared to healthy controls. PMID: 26291814
  47. Specific SHBG variants affecting serum SHBG levels and SHBG haplotypes are associated with polycystic ovary syndrome, suggesting the role for SHBG as polycystic ovary syndrome candidate gene. PMID: 26600064
  48. overlapping of interacting amino acid residues between phthalate compounds and natural ligand, dihydrotestosterone, suggested potential disrupting activity of phthalates in the endocrine homeostasis function of SHBG PMID: 26963243
  49. Data suggest that, in endurance runners using endurance training followed by strength training, an initial reduction in testosterone/SHBG ratio is seen after 12 weeks followed by large increase in weeks 12-24 (as compared to endurance training alone). PMID: 25494869
  50. SHBG levels were lower in women with polycystic ovary syndrome compared to controls. PMID: 25020276

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Isoform 1 and isoform 2 are present in liver and testis.
Database Links

HGNC: 10839

OMIM: 182205

KEGG: hsa:6462

STRING: 9606.ENSP00000369816

UniGene: Hs.632235

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1