Home
Protein
Recombinant Proteins
Recombinant Human Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3), partial

Recombinant Human Signal peptide, CUB and EGF-like domain-containing protein 3 (SCUBE3), partial

^{In Stock}

Code	CSB-EP810287HU
Abbreviation	Recombinant Human SCUBE3 protein, partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Target Names

SCUBE3

Uniprot No.

Q8IX30

Research Area

Cardiovascular

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

804-916aa

Target Protein Sequence

CGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

20.2 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 804-916 constitute the expression domain of recombinant Human SCUBE3. The expected molecular weight for the SCUBE3 protein is calculated to be 20.2 kDa. This protein is generated in a e.coli-based system. The SCUBE3 coding gene included the N-terminal 10xHis tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant SCUBE3 protein in following stages of expression and purification.

Signal peptide, CUB, and EGF-like domain-containing protein 3 (SCUBE3) contains a signal peptide for secretion, as well as CUB (Complement C1r/C1s, Uegf, Bmp1) and EGF-like domains, suggesting a role in cell adhesion and signaling. SCUBE3 has been implicated in angiogenesis, where it interacts with vascular endothelial growth factor (VEGF) and modulates VEGF-mediated signaling pathways. Additionally, it has been associated with platelet function, playing a role in platelet aggregation and adhesion.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Binds to TGFBR2 and activates TGFB signaling. In lung cancer cells, could serve as an endogenous autocrine and paracrine ligand of TGFBR2, which could regulate TGFBR2 signaling and hence modulate epithelial-mesenchymal transition and cancer progression.

Gene References into Functions

The results of this pioneering study indicate that SCUBE protein family appears to have a probable role in the pathogenesis and angiogenesis development in psoriasis and SCUBE 1 and 3 may be novel markers of angiogenesis in psoriasis. PMID: 28238185
Elevated expression of SCUBE3 in osteosarcoma tissues correlated with poor prognosis of the osteosarcoma patients. PMID: 27259322
Results indicated that SCUBE3 might be involved in regulating the epithelial-mesenchymal transition (EMT) and malignant progression in NSCLC. PMID: 24390364
Scube3 facilitates both TGFbeta and Hh signalling within an overall role of facillating inflammatory angiogenesis. PMID: 24084593
results show that SCUBE3 knockdown was associated with lower vascular permeability in the tumor and effectively inhibited the metastatic potential of non-small-cell lung carcinoma PMID: 23420440
in lung cancer cells, SCUBE3 could serve as an endogenous autocrine and paracrine ligand of TGF-beta type II receptor, which could regulate TGF-beta receptor signaling and modulate EMT and cancer progression PMID: 21441952
Observational study of gene-disease association. (HuGE Navigator) PMID: 20546612
may act locally and/or distantly through a proteolytic mechanism, and may play an important role in bone cell biology PMID: 15234972