Recombinant Human Sodium/glucose cotransporter 2(SLC5A2), partial

In Stock
Code CSB-EP021679HU1
Product Type Recombinant Protein
Size US$2062Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P31639
Lead Time 3-7 business days
Relevance Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Research Area Signal Transduction
Source E.coli
Gene Names SLC5A2
Protein Names Recommended name: Sodium/glucose cotransporter 2 Short name= Na(+)/glucose cotransporter 2Alternative name(s): Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2
Expression Region 1-102aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 15.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1
Involvement in disease Renal glucosuria (GLYS)
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Sodium:solute symporter (SSF) (TC 2.A.21) family
Database Links

HGNC: 11037

OMIM: 182381

KEGG: hsa:6524

STRING: 9606.ENSP00000327943

UniGene: Hs.709195

Q&A and Customer Reviews

Q&A
Q:

For the information provided for CSB-YP021679HU1 (all expression systems) is the expression region, tag information, expected tag information, and sequence the same as the CSB-CF021679HU1 ? All of the four expression systems along with the cell free were together.

A:
Thanks for your interest in our product,Yes, the information including the expression region (Expression Region: 1-102aa; Partial.) and sequence provided for CSB-YP021679HU1 (all expression systems) is the the same as the CSB-CF021679HU1.
But the tag has some differences:
As we have already successfully expressed CSB-EP021679HU1 and CSB-CF021679HU1 before, so the tags are confirmed.
The confirmed tag: EP:N-terminal 10xHis-tagged and C-terminal Myc-tagged; CF: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged;
But the tag for other expression systems will be determined during the manufacturing process.
The expected tag for other expression system: YP: N-terminal 6xHis-tagged; BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Customer Reviews

Related Products

SLC5A2 Antibodies

SLC5A2 Antibodies for Homo sapiens (Human)

SLC5A2 Antibodies for Human

SLC5A2 Proteins

SLC5A2 Proteins for Homo sapiens (Human)

SLC5A2 Proteins for Homo sapiens(Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.