Name: Recombinant Human Splicing factor 3B subunit 3 (SF3B3) (T899I), partial
Brand: CUSABIO
SKU: CSB-EP614890HU(M)

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

SF3B3

Uniprot No.

Q15393

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

Pre-mRNA-splicing factor SF3b 130 kDa subunit (SF3b130) (STAF130) (Spliceosome-associated protein 130) (SAP 130)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

819-1217aa(T899I)

Target Protein Sequence

MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNIGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

52.1 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In the production of the recombinant Human SF3B3 protein in e.coli cells, a sequential pipeline involves constructing the expression vector coding for the Human SF3B3 protein (819-1217aa(T899I)), transforming the recombinant vector into e.coli cells, selecting the positive cells and cultivating them, lysing cells, and characterizing the protein. The resulting recombinant Human SF3B3 protein is purified from the cell lysate using affinity purification. Its purity exceeds 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Recombinant proteins and the detection of TAAbs by ELISA

Review: All 15 proteins used in ELISA were purchased from CUSABIO (SF3B3, RUNX1T1, SARS, PAIP1, CAST, MAGEA12, CCDC6, RAD23A, NOL7, CRLF3, NAP1L4, SH2B1, LARP6, Wuhan, China). The scatter dot plot of the optical density (OD) values of ELISA for 8 TAAbs in the specific validation set.

By Anonymous

Read more reviews >>

Target Background

Function

Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.

Gene References into Functions

These results suggest SF3B3 as a key regulator of EZH2 pre-mRNA splicing and SF3B3 may represent a novel prognostic factor and potential therapeutic target in clear cell renal cell carcinoma PMID: 27879367
our findings suggest a role for the elevated expression of SF3B3 in poor prognosis and tamoxifen resistance, leading to recurrence of estrogen receptor-positive breast cancer PMID: 25431237
Report detection of SF3B3 gene mutations in oral cancer using high resolution melting analysis. PMID: 25651737

Subcellular Location

Nucleus.

Protein Families

RSE1 family

Database Links

HGNC: 10770

OMIM: 605592

KEGG: hsa:23450

STRING: 9606.ENSP00000305790

UniGene: Hs.514435

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP614890HU(M)
Abbreviation	Recombinant Human SF3B3 protein (T899I), partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Splicing factor 3B subunit 3 (SF3B3) (T899I), partial

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage