Recombinant Human Src substrate cortactin (CTTN)

Code CSB-YP623911HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP623911HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP623911HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP623911HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP623911HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
CTTN
Uniprot No.
Alternative Names
Amplaxin; CTTN; EMS 1; EMS1; FLJ34459; Mammary tumor and squamous cell carcinoma associated; Oncogene EMS1; p80/85 src substrate; Src substrate cortactin; SRC8_HUMAN
Species
Homo sapiens (Human)
Expression Region
1-513
Target Protein Sequence
MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG FGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG KTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT DRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKT VPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARA KTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDD IITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Contributes to the organization of the actin cytoskeleton and cell shape. Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones. Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density. Plays a role in the invasiveness of cancer cells, and the formation of metastases. Plays a role in focal adhesion assembly and turnover. In complex with ABL1 and MYLK regulates cortical actin-based cytoskeletal rearrangement critical to sphingosine 1-phosphate (S1P)-mediated endothelial cell (EC) barrier enhancement. Plays a role in intracellular protein transport and endocytosis, and in modulating the levels of potassium channels present at the cell membrane. Plays a role in receptor-mediated endocytosis via clathrin-coated pits. Required for stabilization of KCNH1 channels at the cell membrane.
Gene References into Functions
  1. Cortactin (CTTN) silencing in megakaryocyte (MK) phenocopies histone deacetylase 6 (HDAC6) inactivation and knockdown leads to a strong proplatelet formation (PPF) defect. PMID: 29176689
  2. Cortactin expression in carcinoma cells and its known involvement in the EGFR pathway suggest a role for this protein as a target for laryngeal squamous cell carcinoma therapy. PMID: 28885660
  3. Cortactin depletion in HMEC-1 cells results in increased stress fibre contractility and endothelial barrier destabilisation. Secretion of the barrier-stabilising hormone adrenomedullin, which activates Rap1 and counteracts actomyosin contractility, was reduced in supernatants of cortactin-depleted endothelium. Cortactin acts in controlling actomyosin contractility with consequences for endothelial barrier integrity. PMID: 27357373
  4. Data show that cortactin-mediated p21Cip1 nuclear export and degradation facilitating MCP1-induced human aortic smooth muscle cell (HASMC) proliferation. PMID: 27363897
  5. Mena(INV) promotes invadopodium maturation by inhibiting normal dephosphorylation of cortactin at tyrosine 421 by the phosphatase PTP1B. PMID: 27824079
  6. CTTN expression increases EGFR protein levels and enhances the activation of the MAPK signaling pathway. CTTN expression also inhibits the ubiquitin-mediated degradation of EGFR by suppressing the coupling of c-Cbl with EGFR. PMID: 27903975
  7. the study revealed that PTBP1 facilitates colorectal cancer migration and invasion activities by inclusion of cortactin exon 11 PMID: 28404950
  8. Overall, the authors find that p27 directly promotes cell invasion by facilitating invadopodia turnover via the Rac1/PAK1/Cortactin pathway. PMID: 28287395
  9. Tyrosine dephosphorylation of the cytoskeletal scaffold, cortactin, recruits the RhoA antagonist SRGAP1 to relax adherens junctions in response to HGF. PMID: 28983097
  10. cortactin binds to E-cadherin, and that a posttranslational modification of cortactin, RhoA-induced phosphorylation by protein kinase D1 (PKD1; also known as PRKD1) at S298, impairs adherens junction assembly and supports their dissolution. PMID: 27179075
  11. Unique role for PBF in regulating CTTN function to promote endocrine cell invasion and migration. PMID: 27603901
  12. AMPK phosphorylation of cortactin followed by SIRT1 deacetylation modulates the interaction of cortactin and cortical-actin in response to shear stress. Functionally, this AMPK/SIRT1 coregulated cortactin-F-actin dynamics is required for endothelial nitric oxide synthase subcellular translocation/activation and is atheroprotective. PMID: 27758765
  13. These data suggest a model in which cortactin promotes exosome secretion by stabilizing cortical actin-rich multivesicular late endosome docking sites. PMID: 27402952
  14. Cortactin may have an important role in the development of oral tumors in human PMID: 27148699
  15. a dynamic TIP150-cortactin interaction orchestrates directional cell migration via coupling dynamic microtubule plus ends to the cortical cytoskeleton. PMID: 27451391
  16. Amplification of 11q13 resulting in overexpression of CTTN/CCND1 was the most prominent finding, which was observed in 13 of 19 ESCC cases. PMID: 27877079
  17. The cortactin Tyr421 residue is required to promote cell proliferation both in vitro and in vivo. PMID: 27805253
  18. the expression of CTTN, Exo70 and MMP-9 in HCC cells was detected and their relations with the ability of migration and invasion of hepatoma carcinoma cells were evaluated PMID: 27025610
  19. miR-542-3p inhibits the invasion of colorectal cancer cells by targeting CTTN. PMID: 26952924
  20. Cortactin expression in epithelial ovarian carcinoma was closely related to malignant biological behavior PMID: 26243395
  21. the MCP1-induced cortactin phosphorylation is dependent on PLCb3-mediated PKC activation, and siRNA-mediated down-regulation of either of these molecules prevents cortactin interaction with WAVE2 PMID: 26490115
  22. findings reveal that Keap1 regulates cell migration by affecting the subcellular localization and activity of cortactin independently of its role in oxidant stress responses. PMID: 26602019
  23. Host cortactin, PKD1 and actin are recruited by Trypanosoma cruzi extracellular amastigotes based on experiments in fixed and live cells by time lapse confocal microscopy. PMID: 26096820
  24. Study highlights the potential role of CCM3 in regulating tight junction complex organization and brain endothelial barrier permeability through CCM3-ERK1/2-cortactin cross-talk PMID: 26385474
  25. We identified and confirmed that Fra-1 affected the expression level of CTTN and EZR in vitro through LC-MS/MS analyses and western blot technology. PMID: 26330014
  26. acetylation-mimicking mutants of alpha-tubulin and cortactin counteract HDAC6-induced ciliary disassembly. PMID: 26246421
  27. cortactin is crucial in invasion and migration of glioma cells, which may promote the migration and invasion of glioma cells by regulating lamellipodia formation, a process requiring the combination of cortactin and the Arp2/3 complex PMID: 26238396
  28. Findings show CTTN significantly upregulated in colon cancer, while its ectopic expression promotes cell proliferation and tumorigenicity through EGFR-ERK pathway regulation suggesting that CTTN plays an important role in colon cancer progression. PMID: 26151562
  29. The results indicate that cortactin is involved in the regulation of apoptosis induced by VacA in gastric cells. PMID: 26289258
  30. Studied the expression of cortactin in HCT116 cells treated with one of the major components of Chansu, Cinobufagin. PMID: 26134506
  31. These findings suggest that this common cortactin variant may functionally contribute to ALI predisposition by impeding endothelial wound healing. PMID: 26361873
  32. These data suggest a model in which phosphatidylinositol 3,5-bisphosphate binding removes cortactin from late endosomal branched actin networks and thereby promotes net actin turnover. PMID: 26323691
  33. Dysregulation of cortactin and HDAC6 is implicated in the invasiveness and migration of prostate cancer cells. PMID: 26112958
  34. These results implicate that the role of MTSS1 suppresses cell migration and invasion by inhibiting expression of CTTN and as a prognosis biomarker in Glioblastomas PMID: 25385572
  35. Upregulation of CTTN is critical for Vascular endothelial growth factor-C- mediated tumor growth and metastasis of esophageal squamous cell carcinoma. PMID: 25212831
  36. The cortactin SH3 domain contributes to podosome assembly while fascin actin bundling is a master regulator of podosome disassembly in THP-1 macrophages and dendritic cells. PMID: 25601713
  37. Integrated omic analysis of oropharyngeal carcinomas reveals human papillomavirus-dependent regulation of the AP-1 pathway and elevated cortactin protein levels. PMID: 25271301
  38. This review focuses on recently published evidence that endothelial ABPs, such as cortactin, myosin, or alpha-actinin, regulate leukocyte extravasation by controlling actin dynamics, biomechanical properties of endothelia, and signaling pathways PMID: 25848070
  39. c-src-mediated phosphorylation requires RTPAalpha PMID: 24652832
  40. Cortactin, another player in the Lyn signaling pathway, is over-expressed and alternatively spliced in leukemic cells from patients with B-cell chronic lymphocytic leukemia. PMID: 24532043
  41. Cortactin expression promoted the migration, invasion and proliferation of SGC-7901 cells both in vivo and in vitro PMID: 24696610
  42. These findings show that overexpression of PODXL enhanced invadopodia formation and tumor metastasis by inducing Rac1/Cdc42/cortactin signaling network. PMID: 24970760
  43. Mechanistic investigations showed that VEGF-C increased CTTN expression by downregulating Dicer-mediated maturation of miR326, thereby relieving the suppressive effect of miR326 on CTTN expression. PMID: 25205106
  44. association of cortactin with Pfn-1 is regulated by c-Abl-mediated cortactin phosphorylation PMID: 24700464
  45. Data suggest that curcumin is an activator of non-receptor type 1 protein tyrosine phosphatase (PTPN1) and can reduce cell motility in colon cancer via dephosphorylation of pTyr(421)-cortactin (CTTN). PMID: 24465712
  46. Overexpression of cortactin (CTTN) was observed in 126/198 (63.6%) of esophageal squamous cell carcinoma cases and was significantly associated with lymph node metastasis (P = 0.000), pathologic stage (P = 0.000) and poor survival (P<0.001). PMID: 24551190
  47. The present study demonstrated that bladder cancer cells with cortactin knockdown have a reduced capacity to extravasate into the lung from the circulation, due to the decreased invasive character of invadopodia. PMID: 24549769
  48. Studies show that IQGAP1 functions as a hub linking HGF-induced signaling to microtubules and actin remodeling via EB1-IQGAP1-cortactin interactions. PMID: 25022754
  49. expression of a charge-neutralizing cortactin mutant inhibited contraction and actin dynamics during contractile activation. PMID: 24920679
  50. Two amino acid residues confer different binding affinities of Abelson family kinase SRC homology 2 domains for phosphorylated cortactin. PMID: 24891505

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Cell projection, ruffle. Cell projection, dendrite. Cell projection. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, podosome. Cell junction. Cell junction, focal adhesion. Membrane, clathrin-coated pit. Cell projection, dendritic spine. Cytoplasm, cell cortex.
Database Links

HGNC: 3338

OMIM: 164765

KEGG: hsa:2017

UniGene: Hs.596164

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1