Recombinant Human Sulfiredoxin-1 (SRXN1), partial

In Stock
Code CSB-EP887163HU1
Abbreviation Recombinant Human SRXN1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-120aa
Target Protein Sequence
MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human SRXN1 protein expression is initiated by transfecting e.coli cells with a DNA expression vector containing the gene encoding the protein of interest (1-137aa). The subsequent culturing of the cells induces the expression of the desired protein. The protein is equipped with a N-terminal 10xHis tag and C-terminal Myc tag. The resulting recombinant Human SRXN1 protein is collected and purified from the cell lysate through affinity purification, demonstrating a purity greater than 90%, as indicated by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. Does not act on PRDX5 or PRDX6. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase.
Gene References into Functions
  1. NRF2, DJ1 and SRNX1 are commonly expressed in diffusely infiltrating astrocytomas and they can be used in predicting patient prognosis. PMID: 29441509
  2. Study identify a role for Srxn1 as a denitrosylase for neuronal Prx2. Finding points to the NO/Srxn1 pair in a previously unrecognized redox cycle that modulates Prx2 peroxidase activity. PMID: 27821734
  3. Wnt/beta-catenin pathway was stimulated by sulfiredoxin in tumor cell line, with activation of CD44-its target genes-resulting in the promotion of invasion and migration in cervical cancer cell lines. PMID: 28448437
  4. This review will highlight the cumulative effects of sulfiredoxin in various systemic disorders with a strong emphasis on its target activity and the factors influencing its expression in such conditions. PMID: 25460739
  5. The up-regulated expression of Srx was significantly associated with lymph node metastasis, infiltration of vessels, and the depth of cancer invasion. PMID: 28274319
  6. The analysis of SXR polymorphism is a promising tool to predict both the favourable response to corticosteroids and the risk of developing steroid resistance PMID: 27377607
  7. rs6053666 of SRXN1 is associated with cerebrovascular disease in a Finnish cohort PMID: 27226772
  8. Increased expression of Srx protects peroxiredoxins against hyperoxidation in the early stage of hyperglycaemia. PMID: 28202395
  9. We silenced Srx by short hairpin RNA in HeLa and SiHa cells. Diminished Srx expression upregulated E-cadherin expression. The cell invasion and migration activity in the ShSrx group were obviously decreased in HeLa and SiHa cells. PMID: 28351308
  10. Study shows that Srx plays a critical oncogenic role to promote cell invasion and metastasis, which is at least partially due to its stimulation of the MAPK pathway through EGFR deacetylation. PMID: 26290602
  11. This review will summarize the molecular basis of differences in the affinity of Srx for individual Prx and the role of individual component of the Srx-Prx system in tumor progression and metastasis. PMID: 26170166
  12. Gemfibrozil, a lipid-lowering drug, increases myelin genes in human oligodendrocytes via peroxisome proliferator-activated receptor-beta. PMID: 22879602
  13. NRF2 and SRXN1 genetic polymorphisms are associated with breast cancer risk and survival PMID: 22964583
  14. SRX forms a complex with S100A4 (and has stronger affinity for S-glutathionylated S100A4), regulates its activity, and mediates redox regulation of the interaction of S100A4 with nonmuscle myosin heavy chain II-A. PMID: 22934964
  15. Smokers and ex-smokers had significantly more sulfiredoxin expression in their tumors and in patients receiving cytostatic drugs or radiation therapy, sulfiredoxin expression predicted a poor prognosis. PMID: 21943684
  16. Srx functions as a novel component to maintain the balance between H2O2 production and elimination PMID: 22086924
  17. Srx-Prx IV axis is critical for lung cancer maintenance and metastasis, suggesting that targeting the Srx-Prx IV axis may provide unique effective strategies for cancer prevention and treatment. PMID: 21487000
  18. sulfiredoxin 1 is associatd with the pathogenesis of human pulmonary fibrosis. PMID: 20718723
  19. Studies present the 2.1 A crystal structure of human Srx in complex with PrxI, ATP, and Mg(2+). PMID: 19812042
  20. The reduction of the cysteine sulfinic acid moiety within the active site of the peroxiredoxin by sulfiredoxin involves novel sulfur chemistry and the use of ATP and Mg(2+). PMID: 15952770
  21. analysis of the reduction of cysteine sulfinic acid of peroxiredoxin to cysteine by mammalian sulfiredoxin PMID: 16565085
  22. Actin and protein tyrosine phosphatase 1B were identified in vitro as targets of sulfiredoxin 1 (Srx1)-dependent deglutathionylation. PMID: 16818657
  23. Aspartate-187 of peroxiredoxin (Prx) I is the catalytic residue responsible for ATP hydrolysis in the cysteinesulfinic acid reduction of Prx by human sulfiredoxin. PMID: 17176052
  24. 2.6 A crystal structure of the human Srx-PrxI complex [Srx] PMID: 18172504
  25. Reduction of cysteine sulfinic acid in peroxiredoxin by sulfiredoxin proceeds directly through a sulfinic phosphoryl ester intermediate PMID: 18579529
  26. analysis of a protein thiosulfinate intermediate in the reduction of cysteine sulfinic acid in peroxiredoxin by human sulfiredoxin PMID: 18593714
  27. decreased expression in lungs from patients with chronic obstructive pulmonary disorder PMID: 19027064
  28. The current study identifies Sulfiredoxin as a unique target of activator protein-1 (AP-1) activation and TAM67 inhibition. PMID: 19057013
  29. Deglutathionylation of 2-Cys Prx is specifically catalyzed by Srx. PMID: 19561357

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Sulfiredoxin family
Tissue Specificity
Widely expressed with highest levels in kidney, lung, spleen and thymus.
Database Links

HGNC: 16132

OMIM: 617583

KEGG: hsa:140809

STRING: 9606.ENSP00000371388

UniGene: Hs.516830

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*