Recombinant Human Syndecan-4 (SDC4), partial

Code CSB-EP327046HU
Abbreviation Recombinant Human SDC4 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
SDC4
Uniprot No.
Research Area
Neuroscience
Alternative Names
Amphiglycan; MGC22217; OTTHUMP00000031788; ryudocan amphiglycan; Ryudocan; Ryudocan core protein; SDC 4; Sdc4; SDC4_HUMAN; SYND 4; SYND4; syndecan 4; syndecan 4 (amphiglycan, ryudocan); syndecan proteoglycan 4; Syndecan-4; Syndecan4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-145aa
Target Protein Sequence
ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.9kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP.
Gene References into Functions
  1. SDC4 gene silencing affects cell Epithelial Mesenchymal Transition and apoptosis of papillary thyroid cancer through the Wnt/beta-catenin signaling pathway. PMID: 30165731
  2. Downregulation of SDC-4 inhibited FGF signaling through the blockade of ERK1/2 and PI3K/Akt/mTOR activation, thus suppressing cell proliferation and migration. PMID: 28703800
  3. studies are required to show if syndecan-4 concentrations can be marker for prognosis assessment or disease progression PMID: 29232393
  4. Data provide evidence that SDC4 plays important roles in normal physiology of intervertebral disc and cartilage through controlling growth factor signaling and matrix homeostasis. However, several studies to date clearly show that in diseased joints, SDC4 and inflammatory cytokines IL-1beta and TNF-alpha form a positive feedback loop, wherein they control each other's expression and/or activity. [review] PMID: 26796346
  5. This study demonstrates that the shedding of synd4 from Endothelial progenitor cells (EPCs) plays a key role in advanced glycation end products-mediated dysfunction of EPC migration and homing. PMID: 27662820
  6. the Ser179Glu mutant of SDC-4 binds strongly Tiam1, a Rac1-GEF reducing Rac1-GTP by 3-fold in MCF-7 breast adenocarcinoma cells. PMID: 29121646
  7. Syndecan 4 is the biomarker independently distinguishing Heart Failure with preserved ejection fraction and Heart Failure with reduced ejection fraction. PMID: 27448535
  8. The upregulation of syndecan-4 in the eutopic endometrium of endometriosis patients may facilitate the pathogenetic process by promoting invasive cell growth via Rac1, MMP3, and ATF-2. PMID: 27041028
  9. Sdc4 has been identified as a mycobacterial attachment receptor on alveolar epithelial cells. PMID: 27279134
  10. Study has demonstrated that SDC-4 expression was increased in sera and skin of atopic dermatitis (AD) patients, suggesting that SDC-4 may contribute to the development of AD. PMID: 27591995
  11. the present study demonstrated that synd4 was involved in the chemotactic migration of ECs in vitro and in vivo. PMID: 27541034
  12. results suggest that SDC4 alleles affect lipid profile in elderly subjects and may in part mediate the link between LDL-C and longevity. PMID: 26254886
  13. Synd4 shedding is a molecular pathological alteration in the development and maintenance of inflammation-associated atrial fibrillation. PMID: 26261514
  14. Dynamic catch of a Thy-1-integrin alpha5beta1+syndecan-4 trimolecular complex explains extraordinary cancer cell adhesion to the vascular endothelium. PMID: 25216363
  15. Syndecan-4 polymorphisms were associated with essential hypertension, body mass index, and coronary artery disease prevalence in the Tampere adult population cardiovascular risk study. PMID: 25410619
  16. No association was found with SDC4 and breast cancer. PMID: 25361632
  17. Data indicate that depletion of syndecan 4 (S4) in umbilical vein endothelial cells (HUVECs) using shRNA inhibited flow-induced alignment in vitro, which was rescued by re-expression of S4. PMID: 25404299
  18. define a role for TG2 activity at the surface of human macrophages in multiple stages of AC clearance and we propose that TG2, in association with heparan sulphates may exert its effect on AC clearance via a mechanism involving the crosslinking of CD44 PMID: 25449226
  19. syndecan 4 is the predominant heparan sulfate proteoglycan in the glomerular endothelial cells glycocalyx PMID: 25122554
  20. TGM2 up-regulation along with ITGB1 and SDC4 plays an important role in the development of RCC tumors and advanced RCC with metastasis PMID: 23499501
  21. Sdc4 is necessary for activation of the integrin during chemokinesis induced by EGF. PMID: 25202019
  22. in healthy discs, SDC4, through its heparan sulfate side chains, contributes to maintenance of the hypoxic tissue niche by controlling baseline expression of Sox9. PMID: 24558194
  23. High glucose modifies TRPC6 channels and ROS production via SDC-4 in human podocytes. PMID: 24942878
  24. The cytoplasmic V domain of syndecan-4 made a significant contribution to the cellular uptake of octaarginine, whereas the cytoplasmic C1 and C2 domains were not involved in the process. PMID: 24632200
  25. syndecan-4 is differentially expressed in seminomas and nonseminomatous germ cell tumours and might be a useful marker. PMID: 23844358
  26. The more upgraded the NYHA grading, the higher level of serum syndecan-4 protein. PMID: 23948417
  27. Syndecan-4 expression and shedding were increased in failing human myocardium. PMID: 23374111
  28. EGFR are the key mediators of SDC-4 expression in MCF-7 cells. PMID: 23374155
  29. Increased expression of SDC4 and FN may be underlying molecular alteration of osteo-sarcoma which accounts for more aggressive clinical behaviour. PMID: 22531343
  30. studies identify S4 as a regulator of MAPK signaling and address the question of how distinct classes of FGFRs individually contribute to signal transduction in endothelial cells PMID: 22569333
  31. By accruing more syndecan-4 on their surface and also shedding it during Th1 cytokine-driven inflammation, asthmatic airway smooth muscle cells may regulate inflammation and remodeling locally and alter the responsiveness of the airways in asthma. PMID: 22268118
  32. in nucleus pulposus, TNF-alpha and IL-1beta regulate SDC4 expression, which plays a key role in pathogenesis of degenerative disc disease by promoting aggrecan degradation by ADAMTS-5. PMID: 21949132
  33. SD-4 bearing distinct heparan sulfate moieties plays a pathogenic role in Sezary syndrome and may be targeted for treatment. PMID: 21252093
  34. Expression of syndecan 4 in healthy human breast tissue during menstrual cycle. PMID: 20398359
  35. In dendritic cells, lysophosphatidylcholine-induced phosphorylation of SDC4 by PKCdelta results in a functional inactivation of SDC4 and decreases adhesion and motility. PMID: 20607801
  36. Data found that Wnt5a reduces cell surface levels and promotes ubiquitination and degradation of SDC4. PMID: 20639201
  37. SDC4 promotes cytokinesis in a phosphorylation-dependent manner in MCF-7 breast adenocarcinoma cells. The serine179-phosphorylation and the ectodomain shedding of SDC4 changed periodically in a cell cycle-dependent way. PMID: 20229236
  38. The expression of syndecan-4 protein was significantly enhanced by TNF-alpha in HUVECs. PMID: 17545042
  39. The down-regulation of syndecan-4, a heparan sulfate proteoglycan, decreased SDF-1/CXCL12-mediated HeLa cell invasion. PMID: 19695308
  40. Study identified an overrepresentation of focal amplifications of known (FGFR3, CCND1, MYC, MDM2) and novel candidate genes (MYBL2, YWHAB and SDC4) in stage Ta bladder carcinoma. PMID: 19821490
  41. Syndecan-4 may be a sensor of tension exerted on the matrix [review] PMID: 19538537
  42. Syndecan-4 mediates antithrombin-induced chemotaxis of human peripheral blood lymphocytes and monocytes PMID: 11801740
  43. Clustering induces redistribution of syndecan-4 core protein into raft membrane domains PMID: 11889131
  44. Syndecan-4 core protein mediates the effects of fibroblast growth factor (FGF)2 on cell function. PKCalpha activation and PDZ-mediated formation of a serine/threonine phosphatase-containing complex by syndecan-4 are downstream events of FGF2 signaling. PMID: 12011116
  45. SDC4 regulates inositol phospholipid binding and signaling PMID: 12377772
  46. the focal adhesion component alpha-actinin interacts with syndecan-4 in a beta-integrin-independent manner PMID: 12493766
  47. Syndecan-4 can promote cell spreading in a beta(1) integrin-dependent fashion through PKCalpha and RhoA PMID: 12509413
  48. endotoxin-induced adhesion of leukocytes to endothelium can be reversed by ligation of syndecan-4 with antithrombin's heparin-binding site PMID: 14652650
  49. syndecan-4/CXCR4 complex is likely a functional unit involved in SDF-1 binding PMID: 15033938
  50. human trabecular meshwork cells express only syndecan-1, and not syndecan-4, at the cell surface, and focal adhesion and stress fiber formation occur independent of syndecan-4 PMID: 15572366

Show More

Hide All

Subcellular Location
[Isoform 1]: Membrane; Single-pass type I membrane protein. Secreted.; [Isoform 2]: Secreted.
Protein Families
Syndecan proteoglycan family
Tissue Specificity
Expressed in epithelial and fibroblastic cells.
Database Links

HGNC: 10661

OMIM: 600017

KEGG: hsa:6385

STRING: 9606.ENSP00000361818

UniGene: Hs.632267

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*