Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L(TAF5L)

Code CSB-EP023093HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O75529
Relevance Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias PCAF-associated factor 65 beta
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names TAF5L
Protein Names Recommended name: TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5LAlternative name(s): PCAF-associated factor 65 beta Short name= PAF65-beta
Expression Region 1-325aa
Tag Info N-terminal GST-tagged
Mol. Weight 64.0kDa
Protein Description Full Length of Isoform 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.
Subcellular Location Nucleus
Protein Families WD repeat TAF5 family
Database Links

HGNC: 17304

KEGG: hsa:27097

STRING: 9606.ENSP00000258281

UniGene: Hs.270621

Related Products

TAF5L Antibodies

TAF5L Antibodies for Homo sapiens (Human)

TAF5L Antibodies for Human

TAF5L Proteins

TAF5L Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.