Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L(TAF5L)

Code CSB-EP023093HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names TAF5L
Uniprot No. O75529
Research Area Epigenetics and Nuclear Signaling
Alternative Names 1110005N04Rik; AI849020; OTTHUMP00000037470; OTTHUMP00000037471; PAF65 beta; PAF65-beta; PAF65B; PCAF associated factor 65 beta; PCAF-associated factor 65 beta; TAF 5L; TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor 65 kD; TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor 65 kDa; TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor; TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 5L; TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65kDa; TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L; Taf5l; Taf5l protein; TAF5L_HUMAN
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-325aa
Target Protein Sequence MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 64.0kDa
Protein Length Full Length of Isoform 2
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.
Gene References into Functions
  1. p300 can acetylate DNA-bound Myc:Max complexes and that acetylated Myc:Max heterodimers efficiently interact with Miz-1 PMID: 16126174
  2. The TAF5L gene on chromosome 1q42 is associated tie type 1 diabetes in Russian patients. PMID: 16206511
  3. p300 or PCAF maintains myoblast viability as effectively as added growth factors through mechanisms requiring the acetyltransferase activity of PCAF but not of p300. PMID: 16672693
  4. latent cytoplasmic coactivator TORC2 mediates target gene activation in response to cAMP signaling by associating with CBP/p300 and increasing its recruitment to a subset of CREB target genes PMID: 17476304
  5. PCAF is a histone acetyltransferase which regulates gene transcription. PCAF interacts physically and functionally with PTEN. PTEN acetylation by PCAF block the ability of PTEN to downregulate PI3-K signalling and to induce G1 cell cycle arrest. PMID: 16829519

Show More

Hide All

Subcellular Location Nucleus
Protein Families WD repeat TAF5 family
Database Links

HGNC: 17304

KEGG: hsa:27097

STRING: 9606.ENSP00000258281

UniGene: Hs.270621

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1