Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L (TAF5L)

In Stock
Code CSB-EP023093HU
Abbreviation Recombinant Human TAF5L protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TAF5L
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
1110005N04Rik; AI849020; OTTHUMP00000037470; OTTHUMP00000037471; PAF65 beta; PAF65-beta; PAF65B; PCAF associated factor 65 beta; PCAF-associated factor 65 beta; TAF 5L; TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor 65 kD; TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor 65 kDa; TAF5 like RNA polymerase II p300/CBP associated factor (PCAF) associated factor; TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 5L; TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65kDa; TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L; Taf5l; Taf5l protein; TAF5L_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-325aa
Target Protein Sequence
MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.0kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The generation of the recombinant Human TAF5L protein typically includes the following steps: synthesizing the recombinant plasmid containing the gene encoding the Human TAF5L protein (1-325aa), transforming the recombinant plasmid into e.coli cells, selecting the positive e.coli cells, and culturing the positive e.coli cells for protein expression. The protein is equipped with a N-terminal GST tag. After expression, affinity purification is employed to isolate and purify the recombinant TAF5L protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human TAF5L protein, revealing a purity level exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. With TAF6L, acts as an epigenetic regulator essential for somatic reprogramming. Regulates target genes through H3K9ac deposition and MYC recruitment which trigger MYC regulatory network to orchestrate gene expression programs to control embryonic stem cell state.
Gene References into Functions
  1. p300 can acetylate DNA-bound Myc:Max complexes and that acetylated Myc:Max heterodimers efficiently interact with Miz-1 PMID: 16126174
  2. The TAF5L gene on chromosome 1q42 is associated tie type 1 diabetes in Russian patients. PMID: 16206511
  3. p300 or PCAF maintains myoblast viability as effectively as added growth factors through mechanisms requiring the acetyltransferase activity of PCAF but not of p300. PMID: 16672693
  4. latent cytoplasmic coactivator TORC2 mediates target gene activation in response to cAMP signaling by associating with CBP/p300 and increasing its recruitment to a subset of CREB target genes PMID: 17476304
  5. PCAF is a histone acetyltransferase which regulates gene transcription. PCAF interacts physically and functionally with PTEN. PTEN acetylation by PCAF block the ability of PTEN to downregulate PI3-K signalling and to induce G1 cell cycle arrest. PMID: 16829519

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
WD repeat TAF5 family
Database Links

HGNC: 17304

KEGG: hsa:27097

STRING: 9606.ENSP00000258281

UniGene: Hs.270621

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*