Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

TXNDC17

Uniprot No.

Q9BRA2

Research Area

Signal Transduction

Alternative Names

TXNDC17; TXNL5Thioredoxin domain-containing protein 17; 14 kDa thioredoxin-related protein; TRP14; Protein 42-9-9; Thioredoxin-like protein 5

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-123aa

Target Protein Sequence

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.9kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human TXNDC17 was expressed with the amino acid range of 1-123. This TXNDC17 protein is theoretically predicted to have a molecular weight of 40.9 kDa. The TXNDC17 protein was expressed in e.coli. The N-terminal GST tag was smoothly integrated into the coding gene of TXNDC17, which enables a simple process of detecting and purifying the TXNDC17 recombinant protein in the following steps.

Thioredoxin domain-containing protein 17 (TXNDC17), also known as TRP14, is a highly conserved and ubiquitously expressed oxidoreductase. It is involved in maintaining cellular redox homeostasis via a thiol-disulfide reductase activity. TXNDC17 is primarily localized to the endoplasmic reticulum (ER), where it participates in disulfide bond formation and is involved in the folding of newly synthesized proteins. Redox regulation within the ER is essential for the proper maturation of proteins that undergo post-translational modifications, including disulfide bond formation, before being transported to their final destinations within or outside the cell.

Target Background

Function

Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.

Gene References into Functions

found STAT3 could bind promoter region of TXNDC17 (-623 bp to -58 bp relative to the transcription start site (TSS)) for regulating its expression PMID: 26976343
TXNDC17, through participation of BECN1, induces autophagy and consequently results in paclitaxel resistance in ovarian cancer PMID: 25607466
The oxidoreductase activities of TRP14 thereby complement those of Trx1 and must therefore be considered for the full understanding of enzymatic control of cellular thiols and nitrosothiols. PMID: 24778250
TRP14 is a thioredoxin-related protein with roles in tumor necrosis factor-alpha signaling pathways PMID: 14607843
TRP14 is a thioredoxin-related protein of 14 kDa PMID: 14607844
Data report the crystal structure of human thioredoxin-related protein 14 determined at 1.8-angstrom resolution. PMID: 15355959
LC8 binds IkappaBalpha in a redox-dependent manner and thereby prevents its phosphorylation by IKK. TRP14 contributes to this inhibitory activity by maintaining LC8 in a reduced state. PMID: 18579519

Hide All

Subcellular Location

Cytoplasm.

Protein Families

Thioredoxin family

Tissue Specificity

Ubiquitously expressed in cell lines.

Database Links

HGNC: 28218

KEGG: hsa:84817

STRING: 9606.ENSP00000250101

UniGene: Hs.408236

Code	CSB-EP025376HU
Abbreviation	Recombinant Human TXNDC17 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP025376HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TXNDC17. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP025376HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TXNDC17.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Thioredoxin domain-containing protein 17 (TXNDC17)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage