Recombinant Human Thioredoxin domain-containing protein 17 (TXNDC17)

In Stock
Code CSB-EP025376HU
Abbreviation Recombinant Human TXNDC17 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP025376HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TXNDC17.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP025376HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TXNDC17.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TXNDC17
Uniprot No.
Research Area
Signal Transduction
Alternative Names
TXNDC17; TXNL5Thioredoxin domain-containing protein 17; 14 kDa thioredoxin-related protein; TRP14; Protein 42-9-9; Thioredoxin-like protein 5
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-123aa
Target Protein Sequence
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.9kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human TXNDC17 was expressed with the amino acid range of 1-123. This TXNDC17 protein is theoretically predicted to have a molecular weight of 40.9 kDa. The TXNDC17 protein was expressed in e.coli. The N-terminal GST tag was smoothly integrated into the coding gene of TXNDC17, which enables a simple process of detecting and purifying the TXNDC17 recombinant protein in the following steps.

Thioredoxin domain-containing protein 17 (TXNDC17), also known as TRP14, is a highly conserved and ubiquitously expressed oxidoreductase. It is involved in maintaining cellular redox homeostasis via a thiol-disulfide reductase activity. TXNDC17 is primarily localized to the endoplasmic reticulum (ER), where it participates in disulfide bond formation and is involved in the folding of newly synthesized proteins. Redox regulation within the ER is essential for the proper maturation of proteins that undergo post-translational modifications, including disulfide bond formation, before being transported to their final destinations within or outside the cell.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.
Gene References into Functions
  1. found STAT3 could bind promoter region of TXNDC17 (-623 bp to -58 bp relative to the transcription start site (TSS)) for regulating its expression PMID: 26976343
  2. TXNDC17, through participation of BECN1, induces autophagy and consequently results in paclitaxel resistance in ovarian cancer PMID: 25607466
  3. The oxidoreductase activities of TRP14 thereby complement those of Trx1 and must therefore be considered for the full understanding of enzymatic control of cellular thiols and nitrosothiols. PMID: 24778250
  4. TRP14 is a thioredoxin-related protein with roles in tumor necrosis factor-alpha signaling pathways PMID: 14607843
  5. TRP14 is a thioredoxin-related protein of 14 kDa PMID: 14607844
  6. Data report the crystal structure of human thioredoxin-related protein 14 determined at 1.8-angstrom resolution. PMID: 15355959
  7. LC8 binds IkappaBalpha in a redox-dependent manner and thereby prevents its phosphorylation by IKK. TRP14 contributes to this inhibitory activity by maintaining LC8 in a reduced state. PMID: 18579519

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Thioredoxin family
Tissue Specificity
Ubiquitously expressed in cell lines.
Database Links

HGNC: 28218

KEGG: hsa:84817

STRING: 9606.ENSP00000250101

UniGene: Hs.408236

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*