Recombinant Human Transmembrane protein 106B (TMEM106B), partial

Code CSB-YP023674HU3
Abbreviation Recombinant Human TMEM106B protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
TMEM106B
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
120-254aa
Target Protein Sequence
SIDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.0 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching.
Gene References into Functions
  1. TMEM106B drives lung cancer metastasis by inducing TFEB-dependent lysosome synthesis and secretion of cathepsins. PMID: 30013069
  2. These findings illustrate the profound effect of TMEM106B haplotypes on brain health and highlight the importance to better understand TMEM106B's function and dysfunction in the context of neurodegenerative diseases. PMID: 29970152
  3. This study demonstrated that in Chinese patient minor alleles of rs1990622 and rs3173615 in TMEM106B may be associated with PD patients with initial symptom of rigidity/bradykinesia. PMID: 28477711
  4. Single-nucleotide polymorphisms in the TMEM106B gene have been identified as a risk factor in frontotemporal dementia (FTD). PMID: 28888721
  5. A common causal variant underlying both association with disease and association with TMEM106B expression in lymphoblastoid cell lines. PMID: 29056226
  6. Study developed a TMEM106B transgenic mouse model that recapitulates the interaction between progranulin and TMEM106B in human patients and supports a regulation of TMEM106B by progranulin in the aged brain and a role of TMEM106B in frontotemporal lobar degeneration-progranulin disease progression. PMID: 28126008
  7. This review revealed TMEM106B variants as significant contributors to one's risk of developing various TDP-43 proteinopathies, both in patients harboring disease-causing mutations and in subjects with TDP-43 pathology of unknown cause. PMID: 27543298
  8. TMEM106B enhances the benefit of cognitive reserve on brain structure in fronto-temporal dementia. PMID: 28460069
  9. we expanded our understanding of the TMEM106B haplotype that is protective against TDP-43 proteinopathy. PMID: 28441426
  10. These findings suggest that the up-regulation of TMEM106B may increase the risk of frontotemporal lobar degeneration by directly causing neurotoxicity and a pathological phenotype linked to FTLD-TDP. PMID: 27563066
  11. Endogenous TMEM106B was partly sequestered in CHMP2B-positive structures. The roles of SNPs T185, S185, or S134N in endosomal sorting complexes required for transport were studied. T185 is a risk factor in neurodegeneration with endolysosomal defects. PMID: 26651479
  12. Study suggests that TMEM106B is associated with frontotemporal dementia, although the extent of this effect is difficult to be estimated by using clinical frontotemporal dementia series PMID: 25096617
  13. It is a risk factor for frontotemporal lobar degeneration. PMID: 25085782
  14. TMEM106b variability does not influence Alzheimer disease risk or plasma progranulin levels. PMID: 25114081
  15. Common variants in TMEM106B serve as a distinct risk factor for TDP-43 pathology in older persons without frontotemporal lobe dementia. PMID: 25653292
  16. The HpScl groups (Hippocampual Sclerosis and Hippocampual Sclerosis-AD) were more likely to exhibit genetic variants in TMEM106B that are associated with frontotemporal lobar degeneration. PMID: 24899141
  17. results show that, in nondemented persons, TMEM106B influences the volume of temporal brain regions that are important for language processing. PMID: 24731779
  18. Neuronal TMEM106B plays a central role in regulating lysosomal size, motility and responsiveness to stress, highlighting the possible role of lysosomal biology in FTLD-TDP. PMID: 25066864
  19. Data provide an initial neuropathological characterization of the newly discovered frontotemporal lobar degeneration-associated protein TMEM106B PMID: 24252750
  20. This study confirmed that specific TMEM106B single-nucleotide polymorphisms is associated with HS-Aging pathology in the Alzheimer disease. PMID: 25470345
  21. Study identifies TMEM106B as the first genetic factor modifying disease presentation in C9ORF72 expansion carriers PMID: 24385136
  22. Study demonstrates that TMEM106B is the first reported genetic modifier in C9orf72 expansion-related frontotemporal lobar degeneration PMID: 24442578
  23. This study demonstrate that TMEM106B and APOE interact to increase late-onset Alzheimer's disease in Han Chinese. PMID: 24166182
  24. Regulated intramembrane proteolysis of the frontotemporal lobar degeneration risk factor, TMEM106B, by signal peptide peptidase-like 2a (SPPL2a). PMID: 24872421
  25. These data show that TMEM106B/MAP6 interaction is crucial for controlling dendritic trafficking of lysosomes, presumably by acting as a molecular brake for retrograde transport. PMID: 24357581
  26. TMEM106B polymorphism modulates brain connectivity in granulin mutation carriers. PMID: 24343233
  27. These findings suggest that low TMEM106B levels might protect against frontotemporal lobar degeneration TAR DNA binding protein 43 in these patients PMID: 23742080
  28. TMEM106B is localized in the late endosome/lysosome compartments and TMEM106B levels are regulated by lysosomal activities. PMID: 23136129
  29. This study demonistrated that aberrant overexpression of TMEM106B affects the distribution and intracellular levels of progranulin, suggesting that the two proteins may act in the same pathogenic pathway in FTLD-TDP. PMID: 22895706
  30. Our data implicate TMEM106B in the pathological presentation of Alzheimer Disease. PMID: 22855871
  31. Endogenous as well as overexpressed TMEM106B localizes to late endosomes and lysosomes. Interestingly, the inhibition of vacuolar H(+)-ATPases significantly increased the levels of TMEM106B. PMID: 22511793
  32. Our results suggest that genetic variation in TMEM106B (rs1990622) may influence risk for frontotemporal lobar degeneration with TAR DNA-binding protein inclusions (FTLD-TDP) by modulating secreted levels of GRN. PMID: 21220649
  33. FTLD-TDP risk gene TMEM106B is involved in the development of cognitive impairment in amyotrophic lateral sclerosis. PMID: 21104415
  34. This study strongly supported TMEM106B as a risk gene for frontotemporal lobar degeneration. PMID: 21354975
  35. The genome-wide association study revealed a strong association between FTLD-TDP and several single nucleotide polymorphisms (SNPs) that mapped in the region of the TMEM106B gene PMID: 20383883
  36. Variants in TMEM106B are strong risk factors for frontotemporal lobar degeneration with TDP-43 inculsions. PMID: 20154673

Show More

Hide All

Involvement in disease
Ubiquitin-positive frontotemporal dementia (UP-FTD); Frontotemporal dementia and/or amyotrophic lateral sclerosis 1 (FTDALS1)
Subcellular Location
Late endosome membrane; Single-pass type II membrane protein. Lysosome membrane; Single-pass type II membrane protein. Membrane; Lipid-anchor.
Protein Families
TMEM106 family
Tissue Specificity
Expressed in frontal cortex.
Database Links

HGNC: 22407

OMIM: 105550

KEGG: hsa:54664

STRING: 9606.ENSP00000379901

UniGene: Hs.396358

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*