Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial (Active)

In Stock
Code CSB-MP023986HU(F2)
Abbreviation Recombinant Human TNFSF11 protein, partial (Active)
MSDS
Size $136
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF11 at 2 μg/ml can bind Human TNFRSF11B (CSB-MP023969HU). The EC50 is 4.514-5.152 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF11 at 2 μg/mL can bind Human TNFRSF11B (CSB-MP023969HU). The EC50 is 4.514-5.152 ng/mL.
Target Names
Uniprot No.
Alternative Names
Tumor necrosis factor ligand superfamily member 11; Osteoclast differentiation factor (ODF); Osteoprotegerin ligand (OPGL); Receptor activator of nuclear factor kappa-B ligand (RANKL); TNF-related activation-induced cytokine (TRANCE); Tumor necrosis factor ligand superfamily member 11, membrane form; Tumor necrosis factor ligand superfamily member 11, soluble form; CD254; TNFSF11; OPGL, RANKL, TRANCE
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
63-244aa
Target Protein Sequence
GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Mol. Weight
22.7 kDa
Protein Length
Partial of Isoform 2
Tag Info
N-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

RANKL is the principal cytokine driving osteoclast differentiation and a key activator of NF-κB signaling, making it indispensable in bone biology and tumor microenvironment research. This recombinant human TNFSF11 partial protein (residues 63–244 of Isoform 2), expressed in mammalian cells with an N-terminal 6xHis tag, demonstrates strong binding to its decoy receptor osteoprotegerin (TNFRSF11B) with an EC50 of 4.514–5.152 ng/mL in functional ELISA, confirming signaling-competent conformation suitable for osteoclast differentiation assays, NF-κB pathway activation studies, and use as a coating antigen or positive control in antibody development workflows. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg satisfy the stringent criteria needed to prevent LPS-driven artifacts in primary monocyte and macrophage precursor cultures. These specifications also provide a suitable basis for in vivo tumor biology models where RANKL-mediated signaling influences metastatic bone disease.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*