Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody(CSB-RA023992MA1HU). The EC50 is 0.8389-0.9731 ng/mL.

Target Names

TNFSF15

Uniprot No.

O95150-2

Alternative Names

TL1, VEGI

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-192aa

Target Protein Sequence

MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Mol. Weight

24.6 kDa

Protein Length

Full Length of Isoform 2

Tag Info

N-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TNFSF15 functions as a death domain-containing receptor ligand implicated in endothelial cell apoptosis and tumor angiogenesis suppression, making it a target of interest in cancer biology and vascular remodeling studies. This full-length isoform 2 construct (aa 1–192) demonstrates specific receptor engagement in a functional ELISA, binding an anti-TNFSF15 recombinant antibody with an EC50 of 0.84–0.97 ng/mL, confirming that the folded ectodomain retains native epitope presentation suitable for antibody development, validation panels, and receptor-binding competition assays. The endotoxin level below 1.0 EU/μg meets the quality thresholds commonly required for cell-based apoptosis assays, endothelial activation studies, and NF-κB or MAPK signaling pathway experiments where LPS contamination would confound interpretation of TNFSF15-specific effects. Purity exceeding 95% by SDS-PAGE, combined with the validated binding activity, supports use as a coating antigen in ELISA development and as a positive control in Western blot or flow cytometry protocols targeting this ligand.

Code	CSB-MP023992HU(F2)
Abbreviation	Recombinant Human TNFSF15 protein (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/ml can bind Anti-TNFSF15 recombinant antibody(CSB-RA023992MA1HU). The EC₅₀ is 0.8389-0.9731 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tumor necrosis factor ligand superfamily member 15(TNFSF15) (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage