Recombinant Human Type-2 angiotensin II receptor (AGTR2), partial

In Stock
Code CSB-EP001466HU
Abbreviation Recombinant Human AGTR2 protein, partial
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
AGTR 2; Agtr2; AGTR2_HUMAN; angiotensin II receptor type 2; Angiotensin II type-2 receptor; Angiotensin receptor 2; AT 2; AT2; ATGR 2; ATGR2; MRX 88; MRX88; Type 2 angiotensin II receptor; Type-2 angiotensin II receptor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-45aa
Target Protein Sequence
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.
Gene References into Functions
  1. Intracrine action of angiotensin II in mesangial cells: subcellular distribution of angiotensin II receptor subtypes AT1 and AT2 PMID: 29455433
  2. rs5193, rs1403543 and rs12710567 of AT2R gene might have no effect on pregnancy-induced hypertension risk among Chinese Han women. PMID: 29714512
  3. It was found that the AGTR2 A-allele is a candidate genetic marker for top-level power athletes. Carriers of the minor allele (A-allele in males and A/A genotype in females) may possess some molecular advantage in developing muscle strength and power traits. PMID: 29561708
  4. Low levels of AT2R is associated with angiogenesis in bladder cancer. PMID: 28599664
  5. angiotensin II type 2 receptor activation in inguinal adipocytes opposes norepinephrine-induced uncoupling protein-1 (UCP1) production and aspects of cellular respiration PMID: 27477281
  6. loss of AT2 R is associated with podocyte loss/dysfunction and is mediated, at least in part, via augmented ectopic hedgehog interacting protein expression in podocytes PMID: 28722118
  7. AGTR2, which encodes angiotensin II receptor type 2, plays a role in modulating uteroplacental circulation and harbors variants that may contribute to the risk of preeclampsia. It is unlikely that the association that we identified with AGTR2 indicates a risk of preeclampsia rather than of spontaneous preterm birth, because women with preeclampsia as a reason for their delivery were excluded from the Nordic studies. PMID: 28877031
  8. In this genomewide association study, we found that variants at the EBF1, EEFSEC, AGTR2, WNT4, ADCY5, and RAP2C loci were associated with gestational duration and variants at the EBF1, EEFSEC, and AGTR2 loci with preterm birth. PMID: 28877031
  9. crystal structures of human AT2R bound to an AT2R-selective ligand and to an AT1R/AT2R dual ligand, capturing the receptor in an active-like conformation PMID: 28379944
  10. Suggest a gender-specific association between the AT2R -1332 A/G polymorphism and the occurrence of carotid plaque and the history of cerebrovascular insult in advanced carotid atherosclerosis. PMID: 27062416
  11. Significant overrepresentation of AT2R-1332 AA genotype in female multiple sclerosis patients was found, compared to female controls. PMID: 27000216
  12. Ang II-induced upregulation of ATF3 and SUMO1 in vitro and in vivo was blocked by Ang II type I receptor antagonist olmesartan. Moreover, Ang II induced ATF3 SUMOylation at lysine 42, which is SUMO1 dependent PMID: 26850942
  13. The A1166C polymorphism of AT1R, A1675G and C3123A polymorphisms of AT2R were analyzed. The A1675G polymorphism of AT2R might be associated with preeclampsia PMID: 25816156
  14. AT2R downregulates the expression of TGF-betaRII in human proximal tubule cells PMID: 26867007
  15. Angiotensin II type 2 receptor is present in human semen and may be involved in the control of sperm motility and male fertility. PMID: 26616438
  16. ATGR2 activation enhances ACE2 expression and activity and prevents TNF-alpha-stimulated ICAM-1 expression . PMID: 26163449
  17. Our results support that the AGTR2 gene may contribute to the pathogenesis of UPJO and the genetic origin of CAKUT could vary according to phenotype expression PMID: 24995698
  18. in colorectal cancer, AT2R expression showed an inverse correlation with tumor stage and liver metastasis PMID: 25138435
  19. Suggest a key regulatory role of ATI and ATII in promoting cellular proliferation in infantile hemangioma, and establish a role for ACE and ATIIR2 in the proliferation of this tumour. PMID: 25713419
  20. The AGTR2 gene C allele is associated with an increased proportion of slow-twitch muscle fibres. PMID: 24887114
  21. Activation of intracellular angiotensin AT receptors induces rapid cell death in non-cycling uterine leiomyosarcoma cells. PMID: 25487516
  22. Type 2 angiotensin II receptor (ATR2) expression was 3.5-fold higher in bronchoalveolar cells 1-6 h after lung with cardiopulmonary bypass transplantation. PMID: 24796630
  23. Loss of angiotensin II type 2 receptor is associated with hepatocellular carcinoma. PMID: 24391821
  24. Ang II induces corneal myofibroblasts resistance to apoptosis via activating NF-kappaB signaling pathway, and thus should be further investigated as a possible target for therapy of corneal fibrosis. PMID: 24917146
  25. These data indicate that the role of AT2R in human diseased arteries is divergent although the AT2R-mediated vasorelaxation prevails. PMID: 24674681
  26. G allele of AT2R - 1332 G:A polymorphism is associated with an increased risk of preeclampsia. PMID: 24440243
  27. Angiotensin II type 2 receptor antagonists could be particularly useful in the treatment of chronic pain and hypersensitivity associated with abnormal nerve sprouting PMID: 23255326
  28. In light of knowledge that AT2 R expression is regulated by oestrogen and that the prevalence of hypertension and cardiovascular risk is greater in women after menopause, AT2 R agonist therapy may represent an approach to treat hypertension. PMID: 23406015
  29. AGTR2 C4599A in mothers, fathers and babies was associated with preeclampsia and this association was only apparent in pregnancies in which the women had a BMI >/= 25 kg/m(2), suggesting a gene-environment interaction. PMID: 23122839
  30. angiotensin II type 2 receptor (AT2R) gene adenine/cytosine (A/C)-3123 polymorphism may be a marker associated with HDL metabolism by hypertension PMID: 22869520
  31. The polymorphism at AT (2) R gene was associated with the risk for aldosterone-producing adenoma. PMID: 21671168
  32. The expression of AT2R in aldosterone-producing adenoma of the adrenal gland was lower than that in normal adrenal gland tissues. AT2R expression was negatively related to plasma aldosterone concentration but positively related with plasma renin activity. PMID: 20714875
  33. Dopamine and angiotensin type 2 receptors cooperatively inhibit sodium transport in human renal proximal tubule cells. PMID: 22710646
  34. In the present study, we showed that the 3123 C/A polymorphism of AGT2R gene is not a significant factor for hypertension in a sample of Tunisian population PMID: 22987376
  35. angiotensin II receptor type 2 receptors are indispensable during islet -like cell clusters maturation in vivo. PMID: 22162314
  36. The data suggested that diameter of the retinal arterioles might be associated with the angiotensin II Type 2 Receptor 1675G/A polymorphism. PMID: 21850060
  37. This study therefore confirms a hypertrophy-modulating effect for AT(2)R also in hypertrophic cardiomyopathy. PMID: 21163866
  38. The present findings suggest that the homozygous form of the ATR gene may make improving systolic blood pressure and some obesity-related metabolic parameters through a dietary intervention difficult among obese women. PMID: 20371166
  39. A1166C genetic variation of the angiotensin II type I receptor gene may not have a major role in susceptibility to coronary heart disease [meta-analysis] PMID: 20732682
  40. ACE DD and AT2R GG genotypes are associated with chronic kidney disease and scarring in PUV PMID: 20149750
  41. Angiotensin II type 2 receptor signaling significantly attenuates growth of murine pancreatic carcinoma grafts in syngeneic mice PMID: 20181281
  42. Variations in AGTR1 and AGTR2 are associated with sudden cardiac arrest risk in a population-based case-control study. PMID: 19716087
  43. The aim of this study was to test the hypothesis that ACE I/D and AT2R 1675G>A are more frequent in patients suffering from the most severe episodes of hypoglycaemia requiring medical emergency treatment. PMID: 19820429
  44. The highest levels of expression of AT2R were found in early and mid TOP placentae compared to term pregnancy. PMID: 20304486
  45. The constitutive and ligand-mediated activity as well as the signal transduction of the AT(2) receptor, focusing on adapter proteins which directly bind to this receptor, is discussed. PMID: 19759061
  46. The loss of AT(2) receptor signalling is associated with increased renal injury and mortality in chronic kidney disease. PMID: 19861345
  47. This review focuses on the role of the AT(2) receptor in the kidney. PMID: 19861347
  48. The role of the AT(2) receptor on cardiovascular structure and disease, and the signalling pathways induced by its activation, is discussed. PMID: 19861349
  49. This review focuses primarily on the common polymorphism -1332G/A of angiotensin II type 2 (AT(2)) receptor but also briefly mentions 3123C/A (located in the 3'-UTR). PMID: 19861351
  50. Novel data from human oesophagus and jejunum suggest that the AT(1) receptor mediates muscular contractions and that the AT(2) receptor regulates epithelial functions. PMID: 19861352

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Expressed in the cerebellum. Very highly expressed in fetal kidney and intestine.
Database Links

HGNC: 338

OMIM: 300034

KEGG: hsa:186

STRING: 9606.ENSP00000360973

UniGene: Hs.405348

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*