Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
TP1B; Non receptor tyrosine phosphatase 1; Protein phosphotyrosylphosphatase 1B; Protein tyrosine phosphatase 1B; Protein tyrosine phosphatase non receptor type 1; Protein tyrosine phosphatase placental; Protein-tyrosine phosphatase 1B; PTN1_HUMAN; PTP 1B; PTP-1B; PTPN 1; PTPN1; Tyrosine protein phosphatase non receptor type 1; Tyrosine-protein phosphatase non-receptor type 1
Species
Homo sapiens (Human)
Expression Region
1-321aa
Target Protein Sequence
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our high-quality Recombinant Human PTPN1 protein is expertly designed for researchers working in the field of signal transduction. This partial Tyrosine-protein phosphatase non-receptor type 1 (Protein-tyrosine phosphatase 1B; PTP-1B) is expressed in an E.coli system and covers the 1-321aa region of the protein. For ease of purification and detection, the PTPN1 protein features both N-terminal 10xHis and C-terminal Myc tags, ensuring consistent performance and trustworthy results throughout your research endeavors.
Our Recombinant Human PTPN1 protein boasts a purity greater than 85% as determined by SDS-PAGE, and is available in both liquid and lyophilized powder forms. Trust this exceptional protein to support your signal transduction research and deliver reliable, high-quality results.