Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Target Names

MYO10

Uniprot No.

Q9HD67

Research Area

Signal Transduction

Alternative Names

(Unconventional myosin-10)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1669-1917aa

Target Protein Sequence

ALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

36.2

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. MYO10 binds to actin filaments and actin bundles and functions as plus end-directed motor. The tail domain binds to membranous compartments containing phosphatidylinositol 3,4,5-trisphosphate or integrins, and mediates cargo transport along actin filaments. Regulates cell shape, cell spreading and cell adhesion. Stimulates the formation and elongation of filopodia. May play a role in neurite outgrowth and axon guidance. In hippocampal neurons it induces the formation of dendritic filopodia by trafficking the actin-remodeling protein VASP to the tips of filopodia, where it promotes actin elongation. Plays a role in formation of the podosome belt in osteoclasts.; Functions as a dominant-negative regulator of isoform 1, suppressing its filopodia-inducing and axon outgrowth-promoting activities. In hippocampal neurons, it increases VASP retention in spine heads to induce spine formation and spine head expansion.

Gene References into Functions

miR-129 inhibited neuroblastoma growth and potentiated chemosensitivity by targeting MYO10 PMID: 29864913
In two cohorts with available data, we identified one intronic SNP (rs13361131) in myosin X gene (MYO10) associated with C17:0 level (P = 1.37x10-8), and two intronic SNP (rs12874278 and rs17363566) in deleted in lymphocytic leukemia 1 (DLEU1) region associated with C19:0 level (P = 7.07x10-9) PMID: 29738550
MYO10 (myosin X), a direct miR340 target gene, mediated the migration and invasion of breast cancer cells PMID: 26573744
Results suggest that NF-kappaB-regulated miR-124 targets MYO10, inhibits cell invasion and metastasis, and is down-regulated in node-positive NSCLC. PMID: 25749519
Myo10 plays a key role in integrating the actin and microtubule cytoskeletons to position centrosomes and mitotic spindles. PMID: 26235048
New research implicates Myo10 in a number of disease states including cancer metastasis and pathogen infection. PMID: 25819274
PCTK1 regulates spindle orientation through phosphorylation of Ser83 on KAP0, a regulatory subunit of protein kinase A. PMID: 25605337
Elevated MYO10 expression and involvement in invadopodia formation increases the aggressiveness of breast cancer . PMID: 24921915
Study demonstrates a novel biological function for Hdl-Myo10 and an important new role for both Myo10 isoforms in the development of dendritic spines and synapses. PMID: 23943878
Myo10 upregulation in mutant p53-driven cancers is necessary for invasion and that plasma-membrane protrusions. PMID: 24487586
Phosphorylation of ADD1 at Ser12 and Ser355 by cyclin-dependent kinase 1 enables ADD1 to bind to myosin-X (Myo10). PMID: 24379415
Authors conclude thatMyo10 generates the force to enhance bacterial-induced cell membrane protrusions by binding its head region to actin filaments and its PH tail domain to the peripheral membrane. PMID: 23083060
Molecular basis by which myosin-X facilitates alternative dual binding to cargos and microtubules. PMID: 21642953
The structure of the MyoX MyTH4-FERM tandem in complex with the cytoplasmic tail P3 domain of the netrin receptor DCC, is reported. PMID: 21321230
Results indicate that PtdIns(3,4,5)P binding to the Myo10-PH2 domain is involved in Myo10 trafficking and regulation of filopodia dynamics. PMID: 20930142
Results suggest that VE-cadherin trafficking along filopodia using myosin-X motor protein is a prerequisite for cell-cell junction formation. PMID: 20123970
M10 is a specific motor carrying Mena/VASP from the root to the tip of the filopodia where extension of actin filament takes place PMID: 15158464
Results report that, in addition to full-length myosin 10 (Myo10), brain expresses a shorter form of Myo10 that lacks a myosin head domain. PMID: 16371656
Data demonstrate that Myo10 is a molecular motor that functions in filopodia formation. PMID: 16894163
Our data suggest that CLP functions to increase translation of Myo10 possibly by acting as a chaperone for the emerging Myo10 heavy chain protein. PMID: 18295593
myosin X recognizes the local structural arrangement of filaments in long bundles, providing a mechanism for sorting cargo to distant target sites. PMID: 18599451
increased CLP expression and CLP-mediated Myo10 function are important for skin differentiation and wound reepithelialization PMID: 18818677

Hide All

Subcellular Location

Cytoplasm, cytosol. Cell projection, lamellipodium. Cell projection, ruffle. Cytoplasm, cytoskeleton. Cell projection, filopodium tip. Cytoplasm, cell cortex. Cell projection, filopodium membrane; Peripheral membrane protein. Note=May be in an inactive, monomeric conformation in the cytosol. Detected in cytoplasmic punctae and in cell projections. Colocalizes with actin fibers. Undergoes forward and rearward movements within filopodia. Interacts with microtubules.

Protein Families

TRAFAC class myosin-kinesin ATPase superfamily, Myosin family

Tissue Specificity

Ubiquitous.

Database Links

HGNC: 7593

OMIM: 601481

KEGG: hsa:4651

STRING: 9606.ENSP00000421280

UniGene: Hs.481720

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP884628HU
MSDS	MSDS
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Unconventional myosin-X (MYO10), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage