Recombinant Human Urocortin-3 (UCN3)

Code CSB-EP846570HU
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
UCN3
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
119-161aa
Target Protein Sequence
KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
20.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
Gene References into Functions
  1. Antiamnesic properties of analogs and mimetics of the tripeptide human urocortin 3 PMID: 27262310
  2. In summary, cardiac expression of CRFR1, CRF, and Ucn3 genes is elevated in heart failure and may contribute to the activation of the CRF/Ucn system in these patients. PMID: 27754786
  3. circulating levels elevated and positively correlated with C-reactive protein in polycystic ovary syndrome PMID: 26488073
  4. results show that activation of CRH receptors by CRH ligands stimulates VEGF-A expression in intestinal epithelial cells through the cAMP/CREB pathway PMID: 26350463
  5. The paracrine actions of Ucn3 activate a negative feedback loop that promotes somatostatin release to ensure the timely reduction of insulin secretion upon normalization of plasma glucose. PMID: 26076035
  6. The molecular modifications of urocortin 3[36-38] led to an improved understanding of the relationship between molecular structure and biological activity of this peptide, could be further tested for possible clinical treatment of depression PMID: 25304878
  7. Data suggest that UCN3 expression can serve as a late stage maturation/differentiation marker in beta-cells during pancreogenesis. [REVIEW] PMID: 25148370
  8. SCP inhibits a subpopulation of PVN neurons, especially OTergic magnocellular neurons, by enhancing the activity of GIRK channels via CRF-R2 PMID: 23349753
  9. study showed that Ucn2 and Ucn3 differentially regulate the LPS-induced TNF-alpha and IL-10 expression and secretion in trophoblast explants acting through CRH-R2. Ucn3 has an anti-inflammatory effect. PMID: 22000474
  10. CRH-R1:CRH-R2 ratio varied according to fat-depot type; whereas CRH-R1 expression was higher in sc fat than in visceral fat, the opposite was true for CRH-R2. PMID: 14764822
  11. Expression of Ucn III/SCP in the human heart and kidney as well as brain and pituitary tissues and its presence in plasma and urine. Ucn III/SCP may therefore regulate the cardiac and renal function as a local factor and a circulating hormone. PMID: 15070962
  12. Ucn 3 plays some physiological or pathological roles in the modulation of gastrointestinal functions during stressful conditions. PMID: 15949638
  13. Ucn3 is produced in the normal adrenal gland and in adrenal tumors (both adrenocortical tumors and pheochromocytomas) and acts as an autocrine or paracrine regulator in both the normal and cancerous adrenal gland tissue. PMID: 16095756
  14. the SCP/CRHR2 system is present in human ovaries and treatment with SCP/Ucn3 inhibits progesterone production by cultured granulosa-lutein cells through interaction with CRHR2 PMID: 19351656

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Sauvagine/corticotropin-releasing factor/urotensin I family
Database Links

HGNC: 17781

OMIM: 605901

KEGG: hsa:114131

STRING: 9606.ENSP00000369798

UniGene: Hs.511775

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*