Recombinant Human Vitamin D-binding protein(GC),partial

In Stock
Code CSB-YP009306HU
Product Type Recombinant Protein
Size US$2010Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P02774
Relevance Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP009306HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) GC.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP009306HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) GC.
Storage Buffer Tris-based buffer,50% glycerol
Alias Gc protein-derived macrophage activating factor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
Research Area Signal Transduction
Source Yeast
Gene Names GC
Protein Names Recommended name: Vitamin D-binding protein Short name= DBP Short name= VDB Alternative name(s): Gc-globulin Group-specific component
Expression Region 19-474aa
Tag Info N-terminal 6xHis-SUMOSTAR-tagged
Mol. Weight 67.0kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.
Subcellular Location Secreted
Protein Families ALB/AFP/VDB family
Tissue Specificity Expressed in the liver. Found in plasma, ascites, cerebrospinal fluid and urine.
Database Links

HGNC: 4187

OMIM: 139200

KEGG: hsa:2638

STRING: 9606.ENSP00000421725

UniGene: Hs.418497

Q&A and Customer Reviews

Q&A
Q:

Could you quote the following product?
1. Is 10ug the minimum quantity?
2. What is the shelf life of both liquid form and powder form?

A:
Very nice to receive your inquiry. Recombinant Human Vitamin D-binding protein(GC),partial
CSB-YP009306HU 15-20 working days
CSB-EP009306HU 3-5 working days
Expression Region: 19-474aa, fragment
Tag Info: YP: N-terminal 6xHis-tag; EP: N-terminal 6xHis-tag
Target Protein Sequence:

RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL


1) CSB-YP009306HU is a customized protein, and the smallest size is 500ug. CSB-EP009306HU is a stock protein, and the smallest size is 10ug.
2) The shelf life of liquid-form protein will be 6 months around at -20℃/-80℃. The shelf life of lyophilized form is 12 months around at -20℃/-80℃.
Q:

I am interested in the Recombinant Human Vitamin D-binding protein(GC) product that you manufacture and would very much appreciate if you would answer all my questions.
1. First and most importantly, is this protein registered with the FDA as a food source, or a pharmaceutical?
2. Are there any license/credentials required to be able to obtain this product from you?
3. Could you tell me how other companies are using the protein?
4. What are your recommended uses for this ingredient?
5. Are there any ingredients that if you were to add your protein to it, that would render the protein unsafe, or cause the protein to lose its potency?
6.What would be the best stabilizing ingredients to go along with the protein?
7. Which of the two kinds that you sell would perform the best and have the longest shelf-life?
8. when/why would you choose the liquid over the freeze-dried version?
9. Are there any restrictions adding it to a cream base that you know of?
10. Any applications you don't advise using it in or for?
11. What are the best fats to combine with the protein for it to be the most effective it can be?
12. When you mention "buffer" I'm assuming you're talking about buffering the protein with other ingredients, in a cream/gel etc.?
13. What is the cost of the protein and in what sizes do you sell them?
14. what is the recommended usage rate of both your products?

A:
Very nice to receive your inquiry. The reply is as follows:
1. Our products are only used for scientific research and have not passed FDA certification.
2. This product can be purchased directly without a license/certificate.
3. This protein is only used for scientific research and is not used for other purposes.
As for the application of this protein, we did not test it. The literature we found is all about the research on the structure and activity-related factors of this protein, providing references:
http://www.uniprot.org/uniprot/P02774/publications
https://www.ncbi.nlm.nih.gov/pubmed/? Term = Vitamin % 20 d - binding protein % 20
4. This protein has been analyzed for its immunogenicity, which is good for immunogenicity experiments.
5. We the default buffer is Tris - -based buffer, 50% glycerol, we usually according to the actual circumstances of the protein, to provide the most suitable save buffer to prevent protein instability or failure will not add other ingredients.
6. The form of lyophilized powder theoretically causes the protein to lose water without affecting other functions, but we have not verified it.
7. The shelf life of freeze-dried powder is one year, and the shelf life of liquid state is half a year. When the customer asks for freeze-dried powder or we find that the stability of the protein is not very good, we will advise the customer to choose the form of freeze-dried powder for fear of the loss of protein in the transportation process.
In general, if there is no special case, we will advise the customer to use liquid form.
Q:

We are hoping to get the same lot as a previous order you sent to us: Lot# 03103. Do you know if there has been any change between the expression processes back in 2016 for Lot# 03103, and the current lot that is being expressed?
We are interested in purchasing 2mg of the Yeast-expressed protein, with Endotoxin Removal + Aseptic Processing. Would it be possible to get 2mg of the same protein as lot# 03103, with endotoxin removal and aseptic processing? If so, can you please provide pricing for this quantity?

A:
Thanks for your inquiry. You previously requested for Tag removal, but we were failed to remove the tag, so it was finally shipped with N-terminal 6xHis-tagged; Liquid form; 500ug; Concentration: 0.3mg/ml; Volume: 1.7ml; Buffer: 0.2 μm Sterile Filtered 10mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol; Requirements: Endotoxin Removal and Aseptic processing
We can provide the Datasheet and COA of the previous Lot # 03103 for your reference.
We can meet your demand to provide 2mg of CSB-YP009306HU and keep it the same as Lot # 03103. There is no change between the current and the previous expression processes.
We will keep the same expression process and raw material to maintain batch-to-batch consistency.
Recombinant Human Vitamin D-binding protein(GC), partial
CSB-YP009306HU
Expression Region: 19-474aa; Partial of NM_000583.3
Tag: N-terminal 6xHis-tagged
Requirements:
Liquid form, keep it the same as Lot # 03103.
Buffer: 0.2 μm Sterile Filtered 10mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol
Endotoxin Removal and Aseptic processing
Q:

I ordered this protein last time and I'm very happy with the protein.
I'd like to check if you have this protein in stock now ? I should be able to send an order to you very soon.

A:
Thanks for your inquiry.
CSB-YP009306HU Recombinant Human Vitamin D-binding protein(GC), partial
Expression Region: 19-474aa; Partial.
Tag information: N-terminal 6xHis-sumostar-tagged;
Lead time: 3-7 working days (In Stock)
We checked that you ordered this protein on 2018-0125, Batch: 03683. We still have about 1mg of the same batch protein in stock, but now the protein in stock is in lyophilized, which will be better for long time storage.If you want to order this protein, pls let us know if you need the liquid form or lyophilized form, we can provide the same batch protein both in liquid or lyophilized form.
Customer Reviews

Related Products

GC Antibodies

GC Antibodies for Human

GC Antibodies for Homo sapiens (Human)

GC Proteins

GC Proteins for Homo sapiens (Human)

GC ELISA Kit

GC ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.