Recombinant Human Vitamin D-binding protein(GC),partial

In Stock
Code CSB-YP009306HU
Size US$2010Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP009306HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) GC.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP009306HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) GC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names GC
Uniprot No. P02774
Research Area Signal Transduction
Alternative Names DBP; DBP/GC; GC; Gc globulin; Gc-globulin; GRD3; Group specific component; Group specific component vitamin D binding protein; Group-specific component; hDBP; VDB; VDBG; VDBP; Vitamin D binding alpha globulin; Vitamin D-binding protein; VTDB_HUMAN
Species Homo sapiens (Human)
Source Yeast
Expression Region 19-474aa
Target Protein Sequence RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 67.0kDa
Protein Length Partial
Tag Info N-terminal 6xHis-SUMOSTAR-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

Could you quote the following product?
1. Is 10ug the minimum quantity?
2. What is the shelf life of both liquid form and powder form?

A:
Very nice to receive your inquiry. Recombinant Human Vitamin D-binding protein(GC),partial
CSB-YP009306HU 15-20 working days
CSB-EP009306HU 3-5 working days
Expression Region: 19-474aa, fragment
Tag Info: YP: N-terminal 6xHis-tag; EP: N-terminal 6xHis-tag
Target Protein Sequence:

RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL


1) CSB-YP009306HU is a customized protein, and the smallest size is 500ug. CSB-EP009306HU is a stock protein, and the smallest size is 10ug.
2) The shelf life of liquid-form protein will be 6 months around at -20℃/-80℃. The shelf life of lyophilized form is 12 months around at -20℃/-80℃.
Q:

I am interested in the Recombinant Human Vitamin D-binding protein(GC) product that you manufacture and would very much appreciate if you would answer all my questions.
1. First and most importantly, is this protein registered with the FDA as a food source, or a pharmaceutical?
2. Are there any license/credentials required to be able to obtain this product from you?
3. Could you tell me how other companies are using the protein?
4. What are your recommended uses for this ingredient?
5. Are there any ingredients that if you were to add your protein to it, that would render the protein unsafe, or cause the protein to lose its potency?
6.What would be the best stabilizing ingredients to go along with the protein?
7. Which of the two kinds that you sell would perform the best and have the longest shelf-life?
8. when/why would you choose the liquid over the freeze-dried version?
9. Are there any restrictions adding it to a cream base that you know of?
10. Any applications you don't advise using it in or for?
11. What are the best fats to combine with the protein for it to be the most effective it can be?
12. When you mention "buffer" I'm assuming you're talking about buffering the protein with other ingredients, in a cream/gel etc.?
13. What is the cost of the protein and in what sizes do you sell them?
14. what is the recommended usage rate of both your products?

A:
Very nice to receive your inquiry. The reply is as follows:
1. Our products are only used for scientific research and have not passed FDA certification.
2. This product can be purchased directly without a license/certificate.
3. This protein is only used for scientific research and is not used for other purposes.
As for the application of this protein, we did not test it. The literature we found is all about the research on the structure and activity-related factors of this protein, providing references:
http://www.uniprot.org/uniprot/P02774/publications
https://www.ncbi.nlm.nih.gov/pubmed/? Term = Vitamin % 20 d - binding protein % 20
4. This protein has been analyzed for its immunogenicity, which is good for immunogenicity experiments.
5. We the default buffer is Tris - -based buffer, 50% glycerol, we usually according to the actual circumstances of the protein, to provide the most suitable save buffer to prevent protein instability or failure will not add other ingredients.
6. The form of lyophilized powder theoretically causes the protein to lose water without affecting other functions, but we have not verified it.
7. The shelf life of freeze-dried powder is one year, and the shelf life of liquid state is half a year. When the customer asks for freeze-dried powder or we find that the stability of the protein is not very good, we will advise the customer to choose the form of freeze-dried powder for fear of the loss of protein in the transportation process.
In general, if there is no special case, we will advise the customer to use liquid form.
Q:

We are hoping to get the same lot as a previous order you sent to us: Lot# 03103. Do you know if there has been any change between the expression processes back in 2016 for Lot# 03103, and the current lot that is being expressed?
We are interested in purchasing 2mg of the Yeast-expressed protein, with Endotoxin Removal + Aseptic Processing. Would it be possible to get 2mg of the same protein as lot# 03103, with endotoxin removal and aseptic processing? If so, can you please provide pricing for this quantity?

A:
Thanks for your inquiry. You previously requested for Tag removal, but we were failed to remove the tag, so it was finally shipped with N-terminal 6xHis-tagged; Liquid form; 500ug; Concentration: 0.3mg/ml; Volume: 1.7ml; Buffer: 0.2 μm Sterile Filtered 10mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol; Requirements: Endotoxin Removal and Aseptic processing
We can provide the Datasheet and COA of the previous Lot # 03103 for your reference.
We can meet your demand to provide 2mg of CSB-YP009306HU and keep it the same as Lot # 03103. There is no change between the current and the previous expression processes.
We will keep the same expression process and raw material to maintain batch-to-batch consistency.
Recombinant Human Vitamin D-binding protein(GC), partial
CSB-YP009306HU
Expression Region: 19-474aa; Partial of NM_000583.3
Tag: N-terminal 6xHis-tagged
Requirements:
Liquid form, keep it the same as Lot # 03103.
Buffer: 0.2 μm Sterile Filtered 10mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol
Endotoxin Removal and Aseptic processing
Q:

I ordered this protein last time and I'm very happy with the protein.
I'd like to check if you have this protein in stock now ? I should be able to send an order to you very soon.

A:
Thanks for your inquiry.
CSB-YP009306HU Recombinant Human Vitamin D-binding protein(GC), partial
Expression Region: 19-474aa; Partial.
Tag information: N-terminal 6xHis-sumostar-tagged;
Lead time: 3-7 working days (In Stock)
We checked that you ordered this protein on 2018-0125, Batch: 03683. We still have about 1mg of the same batch protein in stock, but now the protein in stock is in lyophilized, which will be better for long time storage.If you want to order this protein, pls let us know if you need the liquid form or lyophilized form, we can provide the same batch protein both in liquid or lyophilized form.

Target Data

Function Involved in vitamin D transport and storage, scavenging of extracellular G-actin, enhancement of the chemotactic activity of C5 alpha for neutrophils in inflammation and macrophage activation.
Gene References into Functions
  1. VDBP in the cervicovaginal fluid (CVF) independently predicts intra-amniotic infection and imminent preterm delivery in women with PTL, whereas in women with preterm premature rupture of membranes, an elevated VDBP level in CVF is not associated with increased risks of these two outcome variables. PMID: 29879190
  2. SNPs of the VDR and GC genes are associated with vitamin D deficiency in postmenopausal Mexican women. PMID: 30150596
  3. GC rs7041 genotype modified the effects of pregnancy on maternal and placental vitamin D metabolism. PMID: 29196501
  4. Urinary VDBP correlated with proteinuria and renal SLE disease activity index, and predicted the development of proteinuria in lupus nephritis. PMID: 29958502
  5. Findings implied that VDBP rs7041-G and rs3733359-T variants may contribute to increased susceptibility to HCV infection in a high-risk Chinese population. PMID: 30218750
  6. Polymorphisms of VDBP rs4588 and rs2282679 may play a potentially important role in epilepsy susceptibility. PMID: 29993274
  7. The study findings suggested a possible clinical application of uVDPB as an early and a good marker for the detection of early renal disease in type 2 diabetes mellitus Saudi patients. PMID: 29850609
  8. GC gene variant has no effect on 25-hydroxyvitamin D levels. PMID: 28892641
  9. genetic association study in population in north India: Data suggest (1) GT allele of VDBP SNP rs7041, (2) VDBP allelic combination (GC1F/1F: T allele rs4588; C allele rs7041), and (3) GA allele of CYP2R1 SNP rs2060793 are associated with vitamin D deficiency in women with PCOS (polycystic ovarian syndrome) in population studied. (VDBP = vitamin D-binding protein; CYP2R1 = cytochrome P450 family 2 subfamily R member 1) PMID: 28008453
  10. The A allele of VDBP gene polymorphism might be a potential risk factor for progression of chronic urticarial. PMID: 29165650
  11. The present study indicates an association between VDR and vitamin D binding protein Single Nucleotide Polymorphisms and Type 1 Diabetes Mellitus among Turkish subjects. PMID: 29506625
  12. Survival analyses showed that the vitamin D binding protein C allele was correlated with poor disease-free survival (DFS). PMID: 29409465
  13. These findings showed that racial/ethnic variations in bioavailable vitamin D do not explain the lack of association between 25-hydroxyvitamin D and multiple sclerosis in blacks and Hispanics; and they further challenge the biological plausibility of vitamin D deficiency as causal for MS. PMID: 29414925
  14. We observed associations between VDR, GC, and CYP27B1 variants and maternal 25-hydroxyvitamin D concentration. Our results provide additional support for a possible role of genetic variation in vitamin D metabolism genes on vitamin D status during pregnancy. PMID: 29175129
  15. Data show that vitamin D-binding protein (DBP) is elevated in the CSF of temporal lobe epilepsy patients. PMID: 19109932
  16. In a Turkish Parkinson disease cohort, rs7041 of GC was associated with the PD risk. The homozygous major allele carriers for rs2282679, rs3755967 and rs2298850 of GC gene in PD patients with slower progression had significantly higher levels of serum 25OHD. This is the first study demonstrating GC gene as a risk factor for PD. PMID: 27282160
  17. Vitamin D levels are associated with severity of liver fibrosis in chronic hepatitis C genotype 1 patients. Although the rs7041 and rs4588 GC polymorphisms are strong predictors of vitamin D levels, they do not play a direct role in liver fibrosis. PMID: 28809744
  18. Vitamin D binding protein polymorphisms were frequently associated to fibrosis grade in chronic hepatitis C suggesting that they could be used as disease evaluation markers to understand the mechanisms underlying the virus-host interaction. PMID: 29465575
  19. Findings indicate that Gc globulin (GC) rs16847024, retinoid X receptor gamma (RXRG) rs17429130 and retinoid X receptor alpha (RXRA) rs4917356 were candidate susceptibility markers for gestational diabetes mellitus (GDM) in Chinese females. PMID: 27636996
  20. Increased circulating levels of vitamin D binding protein in multiple sclerosis patients. PMID: 25590278
  21. Results show that APOE, DBP and AGT identified were associated with survival outcomes in metastatic colorectal cancer patients treated with chemotherapy and bevacizumab PMID: 25428203
  22. results provide a direct evidence of cross-talk among the structural domains of DBP PMID: 18035050
  23. DBP strictly inhibited the production of 1alpha,25-dihydroxyvitamin D3 and 25-hydroxyvitamin D3-induced T cell responses. PMID: 25230725
  24. 25(OH)D2 half-life was shorter than 25(OH)D3 half-life, and half-lives were affected by DBP concentration and genotype PMID: 24885631
  25. The interaction between vitamin D status, as measured by circulating 25(OH)D and DBP rs2282679 genotypes, modified the association between 25(OH)D and BMD and bone markers PMID: 25890042
  26. Data suggest that, while low circulating levels of DBP contribute to low circulating levels of 25-hydroxyvitamin D in patients with PHPT (primary hyperparathyroidism), low DBP alone is not responsible for the hypovitaminosis D observed in these patients; vitamin D metabolism is likely to be generally disturbed in PHPT. [EDITORIAL] PMID: 27858283
  27. the purpose of this investigation was to assess the relative degree of O-linked trisaccharide glycosylation of DBP in breast, colorectal, pancreatic, and prostate cancer patients compared with healthy individuals. PMID: 19642159
  28. Comparison of Two ELISA Methods and Mass Spectrometry for Measurement of Vitamin D-Binding Protein: Implications for the Assessment of Bioavailable Vitamin D Concentrations Across Genotypes. PMID: 27250744
  29. Single-nucleotide polymorphisms in the vitamin D binding protein genewere independently associated with lower 25-hydroxy-vitamin Dand higher 24,25-dihydroxy-vitamin D. PMID: 27313313
  30. genetic association studies in a population in Brazil: Data suggest that SNPs in RXRG (rs2134095) and GC (rs7041) are associated with low-density lipoprotein cholesterol levels and hypercholesterolemia in the population studied; there was no apparent association with an SNP in VDR (rs2228570). (RXRG = retinoid X receptor gamma; GC = vitamin D-binding protein; VDR = vitamin D receptor) PMID: 27721113
  31. The study strongly suggests that there might have an association of vitamin D, and vitamin D-binding protein gene (codon 416 & 420) polymorphisms with the occurrence of type 2 diabetes mellitus PMID: 28888576
  32. Low serum vitamin D-binding protein concentrations are associated with type 1 diabetes. PMID: 27103201
  33. rs7041 polymorphism of Vitamin D Binding Protein does not affect platelet reactivity or the rate of high-residual platelet reactivity among patients receiving dual antiplatelet therapy with clopidogrel or ticagrelor. PMID: 28433569
  34. High VDBG concentration was associated with coronary heart disease events in all racial and ethnic groups. PMID: 28472285
  35. SNPs rs7041 and rs4588 of VDBP are not associated with the levels of 25-hydroxyvitamin D nor with the prevalence and extent of CAD. 25-hydroxyvitamin D levels but not VDBP genetic status independently predicted the occurrence of coronary lesions at angiography. PMID: 28779988
  36. Genetic variant in vitamin D-binding protein is associated with metabolic syndrome. PMID: 28278285
  37. Study suggests higher (versus lower) circulating DBP may be independently associated with a decreased prostate cancer risk in black men independent of 25(OH)D status. PMID: 28369777
  38. The data demonstrate a relationship between the diurnal rhythms of 1,25(OH)2D and DBP, possibly to maintain free 1,25(OH)2D concentrations. PMID: 28732681
  39. the interaction between 25(OH)D status and some maternal GC variants influence the birth weight of infants PMID: 28241988
  40. The results of this study suggest that DBP is not involved in the pathogenesis of MS in Italians. PMID: 28284354
  41. This report summerizes current understanding of vitamin D-binding protein, its genetic determinants, and their effect on calcifediol concentrations. (Review) PMID: 27742848
  42. Allelic variations in CYP2R1 and GC affect vitamin D levels, but variant alleles on VDR and DHCR7 were not correlated with vitamin D deficiency. PMID: 26038244
  43. Patients with primary hyperparathyroidism have lower serum VDBP than controls. PMID: 27682354
  44. VDBP polymorphism is associated with vitamin D deficiency. PMID: 27768857
  45. genome-wide association study in population of children/adolescents in Colorado: Data suggest that VDBP is an autoantigen in development of autoimmune type 1 diabetes (T1D) in the population studied; serum 25-hydroxyvitamin D levels are negatively correlated with VDBP-autoantibody levels in patients in whom T1D developed during the winter. [META-ANALYSIS] PMID: 26983959
  46. VDBP rs222020 C > T polymorphisms may be predisposition factors of adolescent idiopathic scoliosis and the efficacy of brace treatment. PMID: 27856225
  47. findings do not support a role of an independent effect of the investigated vitamin D-related gene variants, VDBP and CYP27B1, in the risk of Multiple Sclerosis PMID: 27904983
  48. The polymorphisms in the VDR and VDBP genes appeared to be responsible for host susceptibility to human tuberculosis in a Taiwanese population. PMID: 26869016
  49. No association was observed between GC or VDR polymorphisms and breast cancer risk. associations between vitamin D-related genetic variants and breast cancer were not observed overall, although the relationships between vitamin D pathway polymorphisms and breast cancer may be modified by menopausal status and breast tumour subtype PMID: 26631034
  50. In a Pakistani population, no statistically significant associations between SNPs in VDR, DBP, and CYP2R1 and tuberculosis was demonstrated. PMID: 27160686
  51. vitamin D-binding protein polymorphisms and vitamin D deficiency correlate with clinical outcomes for Korean patients with chronic obstructive pulmonary disease PMID: 27103796
  52. None of the common haplotypes (6 in the GC gene and 3 in the VDR gene) were associated with body mass index. Therefore, polymorphisms in the GC and VDR genes were independently associated with obesity and vitamin D levels with a clear sex dimorphism. PMID: 26881316
  53. A causal role of vitamin D status, as reflected by GC rs2282679 genotype, in disease progression and mortality in prostate cancer patients is unlikely. PMID: 26209090
  54. Genetic variants in the vitamin D pathway genes VDBP and RXRA modulate cutaneous melanoma disease-specific survival. PMID: 26575331
  55. Association between common DBP variants and serum protein levels. PMID: 26924582
  56. Vitamin D-binding protein as a biomarker of active disease in acute intermittent porphyria. PMID: 25979770
  57. specific GC gene polymorphism is associated with lower 25(OH)D levels independent of age, sex, and adiposity in Thai subjects PMID: 25370324
  58. Gc-globulin monitoring offers a rapid and accurate method to estimate treatment outcomes on admission and an effective temporal indicator of curative effects in ACHBLF [Acute-on-Chronic Hepatitis B Liver Failure] patients PMID: 25772956
  59. The VDBP genotype GC*1F-1F or allele GC*1F was associated with increased susceptibility to chronic obstructive pulmonary disease in Asians. (Meta-analysis) PMID: 26400306
  60. Direct measurements of free 25(OH)D reduce the differences seen in total 25(OH)D between DBP phenotype groups and sexes, probably caused by differences in DBP concentrations. PMID: 26733479
  61. Urinary VDBP and KIM-1 are potent new biomarkers of major adverse renal events in patients undergoing coronary angiography. PMID: 26751954
  62. Polymorphisms associated with lower DBP level attenuated the association between low serum 25(OH)D3 level and food allergy, consistent with greater vitamin D bioavailability in those with a lower DBP level. PMID: 26260969
  63. The Gc2 variant was associated with a decrease in the frequency of Bronchopulmonary dysplasia . PMID: 26067474
  64. Significant associations were found between the GC (rs2282679 and rs7041), CYP2R1 (rs10741657) single nucleotide polymorphisms and the active form of Vitamin D, 25(OH)D. PMID: 25405862
  65. Subjects with the DBP phenotype 1f/1f had 23 - 26 % reduced risk of incident cancer compared to the 1s/1s and 2/2 phenotypes (P < 0.02, Cox regression with gender as covariate). PMID: 25993554
  66. vitamin D binding protein gene polymorphisms may have a role in ethnic variation of hip fractures PMID: 25920689
  67. Vitamin D-binding protein SNPs are associated with prostate cancer; low 25(OH)D metabolism score and CYP24A1 and CYP27B1 variants are associated with grade PMID: 25488826
  68. Studies indicate that the vitamin D-binding protein 1F allele (GC 1F allele) confers a risk of chronic obstructive pulmonary disease (COPD) in Asians, whereas the 1F allele may protect against COPD in Caucasians. PMID: 25966120
  69. indicate apolipoprotein E (ApoE) and two isoforms of vitamin D binding protein (DBP) as biomarkers to subdivide the multiple sclerosis (MS) patients into subgroups correlated with clinical classification. PMID: 26046356
  70. Despite urinary losses of VDBP, CKD patients had higher serum VDBP concentrations, indicating compensatory enhanced production. Vitamin D binding protein is not involved in vitamin D deficiency. PMID: 26064917
  71. Low 25(OH)D was associated with incident coronary heart disease in whites, but no interactions of 25(OH)D with key DBP genotypes was found. PMID: 25941991
  72. Neither 25(OH)D nor VDBP levels did predict markers of disease progression PMID: 25803709
  73. Low serum 25(OH)D was independently associated with incident HF among whites, but not among blacks. However, in both races, low 25(OH)D was associated with HF risk among those genetically predisposed to high DBP. PMID: 25863973
  74. The GC-1F allele of the vitamin D binding protein was a risk for COPD in recessive mode. PMID: 25488093
  75. Genetic polymorphisms in Gc were associated with lung and colorectal cancers in Thai patients. PMID: 25921141
  76. presence of a particular GC gene allelic version, GC*3, observed for the first time in the Lebanese population, and found to be associated with both normal vitamin D and high DBP levels PMID: 26404398
  77. A genetic association was observed between the Gc-2 allele of vitamin D binding protein and reduced susceptibility to blastomycosis in a Canadian cohort. PMID: 25459678
  78. These findings indicate that VDBP is not directly associated with the risk of CRC, but it modulates circulating free and bioavailable 25(OH)D concentration PMID: 25609140
  79. VDR rs2228570 and DBP rs7041 polymorphisms may contribute to increased susceptibility to HBV-related hepatocellular carcinoma in the Chinese population. PMID: 25541958
  80. The aims of this study were to determine 1) Gc variant frequencies in vitamin D binding protein in a population from an isolated rural region of The Gambia, West Africa. PMID: 25652210
  81. GC variants had a significant association with serum 25-OHD3 levels among postmenopausal women of the Han ethnic group in Beijing. PMID: 25079458
  82. A two-staged analysis demonstrated that rs2282679 in GC was associated with serum 25(OH)D concentration and could be a risk factor for hip fracture in Japanese rheumatoid arthritis patients. PMID: 24646907
  83. the A allele at rs4588 and the T allele at rs7041 modified the association between 25(OH)D and diabetes among whites but not blacks PMID: 25926504
  84. higher circulating VDBP concentrations and higher vitamin D catabolic rate among Caucasian Americans observed here appear to be consistent with lower bone mineral density and racial and ethnic differences in vitamin D-inducing cytokines PMID: 25234352
  85. This meta-analysis demonstrated that the DBP polymorphism was moderately associated with increased susceptibility to T2DM in Asians, but a similar association was not found in Caucasians PMID: 25371416
  86. the dysfunctional GC globulin affected cytokine release, especially the release of MCP-1, and MCP-1 might play important roles in melalgia and migraine. PMID: 25147936
  87. genome-wide association study in population in Finland: Data suggest that two SNPs in VDBP (rs7041, rs705117) and one SNP in ST6GALNAC3 (GalNAc sialyltranferase III; rs12144344) are associated with serum levels of VDBP in the male population studied. PMID: 24740207
  88. GC polymorphism is associated with lung function and risk of chronic obstructive pulmonary disease in a Korean population. PMID: 25048491
  89. Subjects with single nucleotide polymorphisms of GC at rs4588 exhibited greater susceptibility to chronic obstructive pulmonary disease ,higher frequency of exacerbations, emphysema and rapid decline of airflow obstruction in a Japanese population. PMID: 24735339
  90. This study of the DBP gene (TAAA) n polymorphism in women of postmenopausal age revealed a significantly lower incidence of DBP(*) 10 allele and a higher incidence of DBP(*) 11 allele in Russian women with bone fractures. PMID: 24958377
  91. Apparently, the investigated polymorphisms of VDBP, MMP1, ADAM33, and IL8 contribute to the genetic susceptibility to chronic bronchitis induced by dust and toxic agents. PMID: 25739290
  92. genetic association studies in populations in Denmark: Data suggest that an SNP in GC (rs4588) is associated with response to either UVB treatment or vitamin D3 fortification of bread and milk in prevention of vitamin D deficiency in winter. PMID: 25527766
  93. genetic differences in the VDR gene may be involved in the development of AITD and the activity of GD, whereas the genetic differences in the GC and CYP2R1 genes may be involved with the intractability of GD. PMID: 25046415
  94. findings showed that the haplotype Gc2-2 (rs7041 AA and rs4588 TT) had the lowest levels of 25(OH)D compared with other haplotypes that contained at least 1 copy of Gc1 allele; results suggest the common variants of GC are genetic determinants of serum 25(OH)D in Chinese PMID: 24200978
  95. Inheritance of a polymorphism of the GC gene, rs2282679, coding for the vitamin D-binding protein, which is associated with lower serum levels of vitamin D, in a meta-analysis of 3137 melanoma patients, was studied. PMID: 24219834
  96. common polymorphisms in GC and CYP2R1 are associated with serum 25(OH)D concentrations in the Caucasian population and that certain haplotypes may predispose to lower 25(OH)D concentrations in late summer in Denmark. PMID: 24587115
  97. GC1s haplotype carriage may increase the risk of RSV bronchiolitis in infancy and subsequent asthma development. The GC1s haplotype is associated with higher VDBP levels, resulting in less freely available vitamin D. PMID: 24447085
  98. Plasma actin-free VDBP is significantly higher in normal pregnancy than in non-pregnancy women. It is also higher in pre-eclampsia than in normal pregnancy, but not significantly. PMID: 24239294
  99. In healthy adults, biological activity of vitamin D, as assessed by serum PTH, is largely independent of DBP concentrations. PMID: 23857798
  100. the authors identified a DBP genotype (ET/ET [Gc1s/Gc1s]) that is protective against the development of asthma in a population of inner-city Hispanic children. PMID: 24745702

Show More

Hide All

Subcellular Location Secreted
Protein Families ALB/AFP/VDB family
Tissue Specificity Expressed in the liver. Found in plasma, ascites, cerebrospinal fluid and urine.
Database Links

HGNC: 4187

OMIM: 139200

KEGG: hsa:2638

STRING: 9606.ENSP00000421725

UniGene: Hs.418497

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1