Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CACNA2D1

Uniprot No.

P54289

Research Area

others

Alternative Names

CA2D1_HUMAN; CACN A2; CACNA2; Cacna2d1; CACNL2A; Calcium channel L type alpha 2 polypeptide; Calcium channel voltage dependent alpha 2/delta subunit 1; CCHL2A; Dihydropyridine receptor alpha 2 subunit; Dihydropyridine sensitive L type calcium channel alpha 2/delta subunit; Dihydropyridine sensitive L type calcium channel subunits alpha 2/delta; L type calcium channel subunit alpha 2; MHS 3; MHS3; Voltage dependent calcium channel subunit alpha 2/delta 1; Voltage gated calcium channel subunit alpha 2/delta 1; Voltage-dependent calcium channel subunit delta-1; Voltage-gated calcium channel subunit alpha-2/delta-1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

528-668aa

Target Protein Sequence

QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.3 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Human CACNA2D1 contains amino acids 528-668. The calculated molecular weight for this CACNA2D1 protein is 32.3 kDa. This CACNA2D1 protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of CACNA2D1, making it easier to detect and purify the CACNA2D1 recombinant protein in the later stages of expression and purification.

Voltage-dependent calcium channel subunit alpha-2/delta-1 (CACNA2D1) is primarily studied in the fields of neurobiology and neuropharmacology. Within nerve cells, CACNA2D1 participates in the formation and regulation of voltage-dependent calcium channels, playing a crucial role in neural signal transmission and neuronal excitability. Research indicates that CACNA2D1 is associated with certain neurological disorders such as epilepsy and neuropathic pain. Scientists are exploring its precise role in the pathogenesis of these diseases, aiming to provide new targets and strategies for their treatment. Additionally, the study of CACNA2D1 extends to the cardiovascular system, particularly its function in cardiac muscle cells. Its regulatory mechanisms in cardiovascular diseases and arrhythmias are also subjects of considerable interest.

Target Background

Function

The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling.

Gene References into Functions

Using human genome-wide association study (GWAS) data, evidence for association of a CACNA2D1 single-nucleotide polymorphism and primary open angle glaucoma is found. PMID: 29176626
we report an additional patient with the 7q21.11 deletion syndrome and provide evidence that haploinsufficiency for a single gene may not be the disease mechanism. In vitro studies of the interaction between PCLO and CACNA2D1 will be required to examine the hypothesis that combined haploinsufficiency for these two synaptic proteins results in neuronal dysfunction PMID: 28240412
All three patients present with epilepsy and intellectual disability pinpointing the CACNA2D1 gene as an interesting candidate gene for these clinical features. PMID: 25074461
Compound mutation of CACNA2D1 and RANGRF genes were found. To the best of our knowledge, this is the first comprehensive description of the concurrence of these two mutations and histiocytoid cardiomyopathy. PMID: 24438356
High prevalence of CACNA2D1, SCN5A, and CACNB2 genetic variants in the Danish population previously associated with Brugada syndrome has been found in new exome data. PMID: 23414114
Functional expression of CACNA2D1 is inhibited by prion protein expression with competition at glycosylphosphatidylinositol. PMID: 24329154
this study reports the identification and characterization of the human alpha2delta-1 subunit gene promoter region and its regulation by specific transcription factor 1. PMID: 23242029
(Review) In neurons, alpha2delta1 subunits are present mainly in presynaptic terminals; peripheral sensory nerve injury results in up-regulation of alpha2delta1 in dorsal root ganglion neurons, and there is consequent increase in trafficking of alpha2delta1 to their terminals. PMID: 20579869
In neocortical slices from transgenic mice having a point mutation (i.e., R217A) of the alpha2delta-1 subunit of voltage-sensitive calcium channels, pregabalin does not affect potassium-evoked glutamate release, yet inhibits this release in wild-type mice. PMID: 21464332
Results show that mutation of CACNA2D1 gene causes a new varant of SCTS. PMID: 21383000
CACNA2D1 is a novel Brugada Syndrome susceptibility gene. PMID: 20817017
CACNA2D1 has structural domains which contribute to the regulation of N-type calcium channel inactivation PMID: 14602720
Timothy syndrome is a disease of excessive cellular Ca(2+) entry and life-threatening arrhythmias caused by a mutation in the primary cardiac L-type Ca(2+) channel (Ca(V)1.2). PMID: 19001023

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Calcium channel subunit alpha-2/delta family

Tissue Specificity

Isoform 1 is expressed in skeletal muscle. Isoform 2 is expressed in the central nervous system. Isoform 2, isoform 4 and isoform 5 are expressed in neuroblastoma cells. Isoform 3, isoform 4 and isoform 5 are expressed in the aorta.

Database Links

HGNC: 1399

OMIM: 114204

KEGG: hsa:781

STRING: 9606.ENSP00000349320

UniGene: Hs.282151

Code	CSB-EP004407HU
Abbreviation	Recombinant Human CACNA2D1 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Voltage-dependent calcium channel subunit alpha-2/delta-1 (CACNA2D1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage