Recombinant Human CCN family member 5 (CCN5)

Code CSB-EP026120HU(A4)
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CCN5
Uniprot No.
Research Area
Stem Cells
Alternative Names
CCN family member 5; CCN5 ; Connective tissue growth factor like protein; Connective tissue growth factor related protein 58 ; Connective tissue growth factor-like protein; Connective tissue growth factor-related protein 58; CT58 ; CTGF L; CTGF-L; WISP 2; WISP-2; Wisp2; WISP2_HUMAN; Wnt 1 signaling pathway protein 2; WNT1 inducible signaling pathway protein 2; WNT1-inducible-signaling pathway protein 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-250aa
Target Protein Sequence
MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
51.3kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Gene References into Functions
  1. The authors show that, in triple-negative-breast cancer (TNBC) cells enriched with tumor initiating cells, CCN5 significantly blocks cellular growth via apoptosis, reversing epithelial-mesenchymal-transition-signaling and impairing mammosphere formation, thereby blocking the tumor-forming ability and invasive capacity of these cells. PMID: 28450698
  2. by analyzing different estrogen receptor-alpha(ER-a)-positive and ER-a-negative breast cancer cell lines, we defined the role of CCN5 in the leptin-mediated regulation of growth and invasive capacity. PMID: 29370782
  3. CCN3 (Nov) and CCN5 (WISP2) are novel substrates of MMP14. PMID: 27471094
  4. Results show that WISP2 and beta-catenin were more highly expressed in gastric cancer tissues and seem to correlate with early stage or without metastasis. PMID: 28739741
  5. Report opposing effects of CCN2 and CCN5 on fibroblast proliferation and transdifferentiation induced by TGF-beta. PMID: 26218313
  6. Serum WISP2 correlated directly with fatty acid binding protein 4. Serum SFRP5 did not differ between obese (n=32) vs. nonobese (n=25) PCOS women, but reference women had lower SFRP5 (p<5x10(-6) as compared to both PCOS groups). PMID: 25089371
  7. Activation of CCN5 may have the therapeutic potential to kill triple-negative breast cancer. PMID: 25132260
  8. WISP2 has a role in regulating tumor cell susceptibility through EMT by inducing the TGF-beta signaling pathway, KLF-4 expression and miR-7 inhibition. PMID: 24931170
  9. The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia. PMID: 25509878
  10. overexpression of FGFBP1 or loss of WISP-2 expression is closely related to the metastasis, invasion and poor prognosis of gallbladder cancer. PMID: 23592278
  11. Loss of WISP2 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype. PMID: 24498388
  12. We demonstrate that the overexpression of CCN5 in lung fibroblasts suppresses the upregulation in the expression of alpha-SMA and collagen induced by CCN2. PMID: 24276150
  13. WISP2 exerts dual actions in mesenchymal precursor cells; secreted WISP2 activates canonical WNT and maintains the cells in an undifferentiated state, whereas cytosolic WISP2 regulates adipogenic commitment. PMID: 24451367
  14. Regulation of invasion by WISP2 may involve the WNT signalling pathway. PMID: 23893926
  15. WISP2 regulates preadipocyte commitment and PPARgamma activation by BMP4. PMID: 23359679
  16. WISP2 gene expression is regulated both by obesity and by the region between visceral and subcutaneous adipose tissue. PMID: 22616691
  17. Studies suggest a novel regulatory pathway exists through which CCN5 exerts its anti-invasive function. PMID: 22020939
  18. CCN5 represses expression of genes associated with epithelial-mesenchymal transition (EMT) as well as expression of key components of the transforming growth factor beta (TGF-beta) signaling pathway. PMID: 21262769
  19. The CCN5/WISP2 were downregulated in paired comparisons of plexiform neurofibroma and malignant peripheral nerve sheath tumor. PMID: 20010302
  20. Overexpression of WISP2 is associated with breast cancer PMID: 11855747
  21. disruption of WISP-2 signaling by use of antisense oligomers caused a significant reduction in breast tumor cell proliferation PMID: 12659671
  22. WISP2 was overexpressed in gastrointestinal peptide-independent ACTH-independent macronodular adrenal hyperplasia. PMID: 14767469
  23. regulation of phosphorylation of ER-alpha and EGFR may play critical roles in EGF-induced transcriptional activation of WISP-2 gene in breast tumor cells PMID: 15798095
  24. These data demonstrate that the expression of WISP2 is synergistically upregulated in RA synovial fibroblasts by estrogen and WNT pathways, and suggest an involvement in the pathology of the disease. PMID: 16038875
  25. Results suggest that WISP-2 could be a reliable independent marker and that down-regulation or loss of the WISP-2 gene may be associated with the development of salivary gland tumors. PMID: 16525711
  26. WISP-2/CCN5 is a novel signaling molecule that critically participates in the mitogenic action of PMA on noninvasive, WISP-2/CCN5-positive breast tumor cells through PKCalpha-dependent, multiple molecular signal transduction pathways. PMID: 16939222
  27. Data suggest WISP-2/CCN5 silencing may be a critical event during differentiation and progression of pancreatic adenocarcinoma. PMID: 17383817
  28. WISP-2 had greater levels of expression in node-positive tumors; higher levels in both moderate and poor prognostic groups compared with the good prognostic group; greater level in both grade 2 and 3 when compared with grade 1. PMID: 17406949
  29. WISP-2/CCN5 is an important regulator involved in the maintenance of a differentiated phenotype in breast tumor epithelial cells and may play a role in tumor cell invasion and metastasis PMID: 18070926
  30. Loss of CCN5 is associated with gain of oncogenic function of p53 mutants invasiveness in breast cancer PMID: 18559502
  31. CCN5 mRNA and protein level was almost undetectable in poorly differentiated breast cancers compared with the moderately or well-differentiated samples and its expression inversely correlated with lymph node positivity. PMID: 18794149

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
CCN family
Tissue Specificity
Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.
Database Links

HGNC: 12770

OMIM: 603399

KEGG: hsa:8839

STRING: 9606.ENSP00000190983

UniGene: Hs.592145

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*