Recombinant Human WNT1-inducible-signaling pathway protein 2(WISP2)

Code CSB-EP026120HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O76076
Relevance May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CCN family member 5 Connective tissue growth factor-like protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Research Area Stem Cells
Source E.coli
Gene Names WISP2
Protein Names Recommended name: WNT1-inducible-signaling pathway protein 2 Short name= WISP-2 Alternative name(s): CCN family member 5 Connective tissue growth factor-like protein Short name= CTGF-L Connective tissue growth factor-related
Expression Region 1-250aa
Tag Info N-terminal GST-tagged
Mol. Weight 51.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Subcellular Location Secreted
Protein Families CCN family
Tissue Specificity Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.
Database Links

HGNC: 12770

OMIM: 603399

KEGG: hsa:8839

STRING: 9606.ENSP00000190983

UniGene: Hs.592145

Related Products

WISP2 Antibodies

WISP2 Antibodies for Human

WISP2 Antibodies for Homo sapiens (Human)

WISP2 Proteins

WISP2 Proteins for Homo sapiens (Human)

WISP2 ELISA Kit

WISP2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.