Recombinant Human Zinc finger protein GLI1 (GLI1), partial

In Stock
Code CSB-EP009499HU
Abbreviation Recombinant Human GLI1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Gli 1; GLI; GLI family zinc finger 1; GLI Kruppel family member 1; gli1; GLI1_HUMAN; Glioma associated oncogene 1; Glioma associated oncogene homolog 1 (zinc finger protein) ; Glioma associated oncogene homolog; Glioma-associated oncogene; Oncogene GLI; Zfp 5; Zfp5; Zinc finger protein GLI 1; Zinc finger protein GLI1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
921-1106aa
Target Protein Sequence
QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 921-1106 form the expressed segment for recombinant Human GLI1. The expected molecular weight for the GLI1 protein is calculated to be 23.3 kDa. Expression of this GLI1 protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of GLI1, making it easier to detect and purify the GLI1 recombinant protein in the later stages of expression and purification.

The human Zinc finger protein GLI1 is a transcription factor and a key mediator of the Hedgehog signaling pathway. GLI1 plays a critical role in various developmental processes and cell fate determination. GLI1 contains zinc finger DNA-binding domains and acts downstream of Hedgehog ligands. When the Hedgehog pathway is activated, GLI1 translocates to the nucleus, where it regulates the expression of target genes involved in cell proliferation, differentiation, and survival. Dysregulation of GLI1 is associated with various cancers, making it a potential target for cancer therapeutics. Research on Zinc finger protein GLI1 focuses on understanding its precise roles in development, tissue homeostasis, and its implications in cancer progression.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a transcriptional activator. Binds to the DNA consensus sequence 5'-GACCACCCA-3'. Regulates the transcription of specific genes during normal development. Plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling. Plays a role in cell proliferation and differentiation via its role in SHH signaling.; Acts as a transcriptional activator, but activates a different set of genes than isoform 1. Activates expression of CD24, unlike isoform 1. Mediates SHH signaling. Promotes cancer cell migration.
Gene References into Functions
  1. Study showed the expression levels of Gli1 and HER2 were significantly higher in gastric cancer, and they are positively related. Gli1 positive patients live a shorter survival time independently of HER2 status. In addition, suppressing the expression level of Gli1 can decrease the cell viability and migration ability in cells and subcutaneous tumors. PMID: 29321573
  2. The results provide new evidence of Numb and Gli1 on the clinical characteristics of Malignant pleural mesothelioma, which may be helpful in clinical diagnosis and targeted therapy. Further research with larger sample size is needed PMID: 30197333
  3. Frameshift Mutation of GLI1 is associated with Colorectal Cancer. PMID: 28664474
  4. Histone deacetylase 6 (HDAC6) inhibition enhanced glioma stem cells (GSCs) radiosensitivity via inactivating sonic hedgehog protein (SHH)/glioma-associated oncogene homolog 1 (Gli1) pathway. PMID: 29222038
  5. HPI-1 worked more effectively than GANT-58 against breast carcinoma cells. In conclusion, HPI-1 could inhibit cell proliferation, reduce cell invasion and decrease cancer stem cell population in breast cancer cells. To target Gli-1 could be a potential strategy to suppress breast cancer stem cells. PMID: 29734730
  6. High GLI1 expression is associated with unfavorable OS and FPS in patients with gastric cancer. As a member of the Hedgehog signaling pathway, GLI1 co-expressed genes are also largely enriched in PI3K/AKT pathway in gastric cancer. PMID: 29596399
  7. the results suggest that aberrant expression of Gli1 serves a role in HSCR by targeting EDNRB. PMID: 29484400
  8. Abnormal elevation of Gli1 and decrease of miR-361 were found in esophageal cancer tissues. MiR-361 weakened invasion of cancer cells and impeded EMT process via the inhibition of Gli1. PMID: 29125483
  9. Data show that miR-150 inhibits glioma-associated oncogene homolog 1 (Gli1) expression via targeting 3'-UTR of Gli1 gene. PMID: 29081413
  10. Downregulation of miR-150 and elevation of Gli1 promote the development and invasion of colorectal cancer cell Epithelial-mesenchymal transition (EMT). MiR-150 attenuated the progression of colorectal cancer cell EMT via inhibiting Gli1. PMID: 29164577
  11. data collectively suggest that silencing of PRMT1 exerts anti-catabolic and anti-inflammatory effects on IL-1beta-induced chondrocytes via suppressing the Gli-1 mediated Hedgehog signaling pathway, indicating that PRMT1 plays a critical role in OA development and serves as a promising therapeutic target for OA. PMID: 28744817
  12. Shh and Gli1 expression were associated with lymph node metastasis, TNM stage and tumor recurrence, suggesting Shh and Gli1 protein could become the valuable biomarker in evaluating the lymph node metastasis in oral squamous cell carcinoma. PMID: 28886265
  13. we have identified an oncogenic MALAT1-GLI1 fusion gene in all cases of gastroblastoma that may serve as a diagnostic biomarker. PMID: 28731043
  14. Analysis of fibroblasts from a patient with homozygous C-terminal truncation of GLI1 demonstrated that the corresponding mutant GLI1 protein is fabricated by patient cells and becomes upregulated in response to Hh signaling. PMID: 28973407
  15. The results showed that Shh and Gli1 were upregulated in prostate cancer tissues and were targeted by a phytogenic neoplastic compound carnosol. PMID: 28886322
  16. Our finding demonstrated that triple phosphorylation of GLI1 by AMPK on Ser-102, Ser-408 and Thr-1074 increases the cytoplasmic localization and binding stability to E3 ligase beta-TrCP, ultimately driving GLI1 protein degradation. PMID: 28562331
  17. Our results identify a new molecular mechanism involving miR-326 and Arrb1 as regulators of Sonic hedgehog medulloblastoma Cancer stem cells . Specifically, low levels of Arrb1 and miR-326 trigger and maintain Hh/Gli signaling and self-renewal PMID: 28716052
  18. study reveals that the USP48-Gli1 regulatory axis is critical for glioma cell proliferation and glioblastoma tumorigenesis. PMID: 28623188
  19. Gli-1 is a credible indicator for highly aggressive tumor with poor prognosis in gastric cancer patients [meta-analysis] PMID: 27634907
  20. Gli may be critical for lung adenocarcinoma metastasis. A novel Gli inhibitor shows promise as a therapeutic agent by preventing cell migration and invasion in vitro and significantly reducing tumor growth and increasing E-Cadherin expression in vivo. PMID: 27533453
  21. Hedgehog pathway dysregulation contributes to the pathogenesis of human gastrointestinal stromal tumors via GLI-mediated activation of KIT expression. PMID: 27793025
  22. Data demonstrate involvement of transcription and of DNA replication licensing factors by non-transcriptional and transcriptional mechanisms in the GLI-dependent mechanism of action of GANT61 in Ht29 cells. PMID: 27863397
  23. Oxytocin receptor signaling promoted the angiogenic behaviors of HUVECs via Gli1-indcued transcription of HIF-1alpha. PMID: 28445928
  24. Galectin-1 promotes invasion and epithelial mesenchymal transformation in gastric cancer cells via activation of the non-canonical Hh pathway in Gli-1 dependent manner. PMID: 27835885
  25. The mechanism by which GLI1 loss of function sensitized tumor cells to vorinostat-induced apoptosis is at least in part through interactions with vorinostat to alter gene expression in a manner that favored apoptosis. PMID: 26868908
  26. these findings propose that A3AR agonist induces cell cycle arrest and apoptosis in breast cancer stem cells by inhibition of ERK1/2 and GLI-1 cascade. PMID: 28230290
  27. Gli1 could be a stem cell marker and an indicator of poor prognosis in patients with ductal breast carcinoma. PMID: 28965964
  28. Expression of SHH and GLI1 may be useful prognostic markers of Merkel cell carcinoma because increased expression was associated with better prognosis. Report high rate of silent mutations in GLI1 exon 5. PMID: 28551328
  29. Results found that GLI1 expression is regulated by GAL1 in gastric cancer tissue specimen and cell lines. PMID: 27836001
  30. Results indicated that GLI1 activation in TN-IBC as in TNBC, plays a vital role in promoting cell proliferation, motility, tumor growth, and formation of tumor emboli. PMID: 28965853
  31. High gli1 expression is associated with Small Cell Lung Cancer. PMID: 28870922
  32. This inhibitory effect on cell growth was partially rescued by exogenous KRT17 expression. In the KRT17-positive regions in OSCCs, GLI-1 or GLI-2 was frequently detected, and the number of cells with cleaved caspase-3 positive was decreased. CONCLUSIONS: KRT17 promotes tumor cell growth, at least partially, through its anti-apoptotic effect as a result of the KRT17 overexpression by GLIs in OSCC PMID: 28342001
  33. Results indicate that GLI1 is important for maintaining the invasive and mesenchymal-like properties of melanoma cells independent of MITF. PMID: 28635133
  34. The data described herein provide the first identification of a DYRK1A-mediated site of phosphorylation on GLI1 within its NLS and may serve as a valuable mechanism for further understanding Hh signaling modulation. PMID: 28735864
  35. Case Report: gastric pericytoma harboring the exceptionally rare translocation t(7;12) resulting in ACTB-GLI1 gene fusion. PMID: 26980027
  36. USP21 recruits and stabilises Gli1 at the centrosome. PMID: 27621083
  37. Gli1 expression was significantly correlated with T stage lymph node metastasis, and clinical stage of lung squamous cell carcinoma. PMID: 28286162
  38. Gli1 role in cell proliferation and differentiation PMID: 28458545
  39. Gli1 inhibitor GANT61 and SHH siRNA synergistically enhanced cytotoxicity induced by itraconazole in MCF-7 cells. PMID: 27810405
  40. Hedgehog pathway activation in T-cell acute lymphoblastic leukemia predicts response to SMO and GLI1 inhibitors. PMID: 27694322
  41. Our studies demonstrate an important role for smoothened and glioma-associated oncogene homology-1 in gastric cancer and suggest inhibition of hedgehog pathway as a novel and potent strategy to treat gastric cancer patients PMID: 28675107
  42. GANT61, which is a targeted inhibitor of Gli1 and Gli2, decreased cell viability and promoted cell apoptosis. Thus, TGF-b1 induced EMT in neuroblastoma cells to increase their migration. Specifically, EMT induced by TGF-b1 in neuroblastoma cells did not depend on the Smad signaling pathway, and the transcription factor Gli participated in TGF-b1-induced EMT independent of Smad signaling. PMID: 28393230
  43. Gli1 expression was detected in most ERM specimens. Patients who had DR or OCT findings indicating chronic retinal insults showed higher Gli1 expression. Gli1 may have a role in the pathogenesis of ERM after chronic retinal insults. PMID: 28134963
  44. Overexpression of GLI1 through a recurrent MALAT1-GLI1 translocation or GLI1 up-regulation delineates a pathogenically distinct subgroup of plexiform fibromyxomas with activation of the Sonic Hedgehog signalling pathway. PMID: 27101025
  45. Gli1 and Gli2 exhibited different functions in the regulation of p63 expression or proliferation of p63(+) cells in Kras-AR driven tumors. PMID: 27760825
  46. The results from this study demonstrate the potential importance of the two-stem-loop motif as a target region for the inhibition of the CRD-BP-GLI1 RNA interaction and Hedgehog signaling pathway. PMID: 27036131
  47. High expression of gli1 is associated with glioma chemoresistance. PMID: 27662839
  48. High Gli-1 expression is associated with pancreatic cancer. PMID: 26815504
  49. Our study is the first to demonstrate the associations of high nuclear Gli1 expression with resistance to trastuzumab-based NAT and subsequent worse prognosis in HER2-positive disease. These findings suggest that the nuclear Gli1 protein may be a novel target of NAT for HER2-positive breast cancer. PMID: 26526577
  50. GLI is an oncogenic transcription factor in the SHH pathway, and targeting GLI with GANT61 results in favourable antitumour activity and targeted therapy. PMID: 27601167

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.
Protein Families
GLI C2H2-type zinc-finger protein family
Tissue Specificity
Detected in testis (at protein level). Testis, myometrium and fallopian tube. Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract. Isoform 1 is detected in brain, spleen, pancreas, liver, kidney and place
Database Links

HGNC: 4317

OMIM: 165220

KEGG: hsa:2735

STRING: 9606.ENSP00000228682

UniGene: Hs.632702

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*