Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Developmental Biology
Alternative Names
Gli 1; GLI; GLI family zinc finger 1; GLI Kruppel family member 1; gli1; GLI1_HUMAN; Glioma associated oncogene 1; Glioma associated oncogene homolog 1 (zinc finger protein) ; Glioma associated oncogene homolog; Glioma-associated oncogene; Oncogene GLI; Zfp 5; Zfp5; Zinc finger protein GLI 1; Zinc finger protein GLI1
Species
Homo sapiens (Human)
Expression Region
921-1106aa
Target Protein Sequence
QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 921-1106 form the expressed segment for recombinant Human GLI1. The expected molecular weight for the GLI1 protein is calculated to be 23.3 kDa. Expression of this GLI1 protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of GLI1, making it easier to detect and purify the GLI1 recombinant protein in the later stages of expression and purification.
The human Zinc finger protein GLI1 is a transcription factor and a key mediator of the Hedgehog signaling pathway. GLI1 plays a critical role in various developmental processes and cell fate determination. GLI1 contains zinc finger DNA-binding domains and acts downstream of Hedgehog ligands. When the Hedgehog pathway is activated, GLI1 translocates to the nucleus, where it regulates the expression of target genes involved in cell proliferation, differentiation, and survival. Dysregulation of GLI1 is associated with various cancers, making it a potential target for cancer therapeutics. Research on Zinc finger protein GLI1 focuses on understanding its precise roles in development, tissue homeostasis, and its implications in cancer progression.