Recombinant Human Zinc finger protein GLI2(GLI2),partial

Code CSB-YP009500HU
Size US$1916
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names GLI2
Uniprot No. P10070
Research Area Epigenetics and Nuclear Signaling
Alternative Names CJS; Gli 2; GLI family zinc finger 2; GLI Kruppel family member GLI2; GLI2; GLI2_HUMAN; Glioma associated oncogene family zinc finger; HPE9; Oncogene GLI2; PHS2; Tax helper protein 1; Tax helper protein 2; Tax helper protein; Tax responsive element 2 holding protein; Tax responsive element 25 bp sequence binding protein; THP; THP1; THP2; Zinc finger protein GLI2
Species Homo sapiens (Human)
Source Yeast
Expression Region 412-641aa
Target Protein Sequence EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 28.5kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Functions as transcription regulator in the hedgehog (Hh) pathway
Gene References into Functions
  1. Importantly, high expression levels of HIF-1alpha/TGF-beta2/GLI2 correlated robustly with the patient relapse following chemotherapy, highlighting a potential biomarker and therapeutic target for chemoresistance in colorectal cancer. PMID: 29891662
  2. Study found increased expression of GLI2 in osteosarcoma tissues and cell lines and determined that GLI2 is a target of miR-141-3p. PMID: 29251328
  3. In conclusion, our data suggest that overexpression of the Hedgehog components SHH, GLI2 and FOXA2 might be used as markers of an aggressive hemangioma. PMID: 28370639
  4. High GLI2 or PDGFRB expression is associated with unfavorable survival in GC patients. GLI2 can induce PDGFRB expression in GC cells via directly binding to its promoter. In addition, the GLI2-PDGFRB axis might be an important signaling pathway modulating CSC properties of GC cells. PMID: 28975979
  5. Study report that compromised CSL function depends on GLI activation for conversion of human dermal fibroblasts into CAFs, separately from cellular senescence. Decreased CSL upregulates the expression of the ULK3 kinase, which binds and activates GLI2. PMID: 28877478
  6. The authors found that hepatitis C virus derived from hepatitis C patients infected and directly induced the trans-differentiation of human primary fibroblasts into myofibroblasts, promoting fibrogenesis. This effect correlated with the activation of GLI2, one of the targets of Hedgehog signaling pathway previously reported to be involved in myofibroblast generation. PMID: 27476557
  7. role of GLI2-ABCG2 signaling axis for 5Fu resistance in gastric cancer PMID: 28847472
  8. This study showed associations of anorectal malformations with rs3738880 in GLI2 and with previous miscarriages. PMID: 28057877
  9. High GLI2 expression is associated with hepatocellular carcinoma. PMID: 27036048
  10. our findings demonstrate that multiple signaling pathways converge on Gli2 to mediate PTHrP expression and bony invasion, highlighting Gli2 as a therapeutic target to prevent bony invasion in OSCC. PMID: 27738315
  11. the effect gene of the Shh pathway, gli1, was found to have a reduced level of expression along with a decreased expression of gli2. PMID: 26446020
  12. High Gli2 expression is associated with non-small cell lung cancer. PMID: 26936993
  13. GLI2 is a dosage-sensitive gene that may be responsible for the agenesis of corpus callosum observed in the proband. PMID: 27346851
  14. Data suggest that Nrp1 (neuropilin-1) regulates Hedgehog signaling specifically at the level of activation of GLI2 transcriptional activator function; Nrp1 localization to primary cilium does not correlate with Hedgehog signal promotion. These studies were conducted in various cell types. PMID: 28667171
  15. studies identify a novel molecular mechanism of regulation of CD40L by the transcription factor GLI2 in the tumor microenvironment downstream of CCR3 signaling PMID: 28461568
  16. the data suggest that CCRK positively regulates the kinetics by which ciliary proteins such as Smoothened and Gli2 are imported into the cilium, and that the efficiency of ciliary recruitment allows for potent responses to Hedgehog signaling over long time periods. PMID: 28817564
  17. GLI2 is a regulator of beta-catenin and provides insights into its role in tumorigenesis. PMID: 28300597
  18. bioinformatics analysis and luciferase reporter assay predicted the direct binding to miR-125b-5p, which has been reported to function as a tumor suppressor in osteosarcoma. Furthermore, functional experiments validated that cir-GLI2 exerted the tumor-promoting effects on osteosarcoma cells via negatively targeting miR-125b-5p. PMID: 28695772
  19. These results demonstrate that miR-124 is an important downstream target gene of Hh signaling, and the Gli2/miR-124/AURKA axis is essential for the proliferation and growth of human glioma cells. PMID: 28393219
  20. in trophoblasts, GLI2 not only directly bound to the promoter region of gene hsd11b2 to transactivate hsd11b2 but also formed a heterodimer with RNA polymerase II, resulting in up-regulation of hsd11b2 gene transcription PMID: 27379371
  21. GLI2 was identified as a crucial downstream mediator of the pro-fibrotic effects of TGF-beta. PMID: 27793816
  22. this study shows that Gli2 expression was more often positive in advanced non-small-cell lung carcinoma patients refractory to platinum-based chemotherapy PMID: 26762562
  23. Beclin-1 acts as a tumor suppressor by regulating the hedgehog (HH) signaling pathway through Gli2 expression in gastric adenocarcinoma. PMID: 25512258
  24. Overexpression of GLI2 is associated with osteosarcoma progression. PMID: 27460090
  25. MALAT1 promotes gastric cancer proliferation and progression. MALAT1 is a direct target of miR-202 and knockdown of MALAT1 significantly decreases the expression of Gli2 by negatively regulating miR-202. PMID: 27887846
  26. the GLI2 gene may be one of the candidate genes to analyze when an association of pituitary hormone deficiency and developmental defects in posterior pituitary gland. The highly variable phenotype found suggests the presence of additional unknown factors that could contribute to the phenotype observed in these patients. PMID: 27576279
  27. the GLI2 protein level could serve as a feasible marker of ligand-dependent hedgehog activation in pancreatic neoplasms. PMID: 27543868
  28. ALDH1A1 stabilizes the Gli2 protein in an enzyme-independent manner in hepatocellular cancer. PMID: 26896768
  29. GLI2 stabilized glial cell missing-a, a pivotal transcriptional factor for trophoblastic syncytialization. PMID: 26769961
  30. The results do not support our hypothesis that common germline genetic variants in the GLI2 genes is associated with the risk of developing medulloblastoma. PMID: 26290144
  31. GLI2 mutations typically result in pituitary anomalies with or without postaxial polydactyly. PMID: 25974718
  32. Serum starvation significantly up-regulated the expression of Gli1, which in turn increased its key target cIAP2 expression and enhanced NF-kappaB/cIAP2 pathway, resulting in promoting cell survival under serum starvation PMID: 26182949
  33. the JQ1-resistant cells remain dependent on c-MYC that now becomes co-regulated by high levels of GLI2 PMID: 25807524
  34. A relatively high frequency of GLI2 mutations occur in patients with congenital growth hormone deficiency. [Review] PMID: 25878059
  35. hsa-miR-665 and hsa-miR-95 were downregulated in GSRCC but upregulated in intestinal gastric adenocarcinoma, and the relatively differential expression of the miRNAs negatively controlling their target genes, GLI2 and PLCG1 PMID: 25964059
  36. during vertebrate history GLI2 acquired a high level of complexity in the genetic mechanisms regulating its expression during spatiotemporal patterning of the central nervous system (CNS) and limbs. PMID: 25715918
  37. This family confirms the incomplete penetrance of genomic disturbances affecting the GLI2 gene. However, the family presented here is unique as none of the three identified individuals with a GLI2 deletion showed any typical signs of holoprosencephaly PMID: 25820550
  38. We genotyped the SLC6A4 5-HTTLPR (rs4795541, rs25531) and TPH2 1125A>T (rs4290270) variants and evaluated their role in moderating disulfiram treatment for cocaine dependence. PMID: 22925276
  39. miR-218 and its downstream target Gli2, as well as E-cadherin, participate in the anti-invasion process PMID: 25694126
  40. GLI2 forms part of a core HH pathway transcriptional regulatory network that promotes human myeloid leukemic progression and dormant LSC generation PMID: 25889765
  41. SPOP plays critical roles in suppressing gastric tumorigenesis through inhibiting Hh/Gli2 signaling pathway. It may provide an alternative strategy for developing therapeutic agents of gastric cancer in future. PMID: 25204354
  42. Gli2 silencing enhances TRAIL-induced apoptosis and reduces tumor growth in human hepatoma cells in vivo. PMID: 25535898
  43. results indicate that miR-202 acts as a novel tumor suppressor to regulate OS cell proliferation and apoptosis through downregulating Gli2 expression. PMID: 25156120
  44. GLI2 regulated metastasis as well as the progression of osteosarcomas. PMID: 25082385
  45. The 14-3-3zeta-driven contextual changes of Smad partners from p53 to Gli2 may serve as biomarkers and therapeutic targets of TGF-beta-mediated cancer progression PMID: 25670079
  46. Report shows that GLI2 is the novel target gene of DeltaNp63alpha and that DeltaNp63alpha-GLI2 crosstalk in osteosarcoma cells is a necessary event in osteosarcoma progression. PMID: 25085524
  47. Increased GLI2 expression is associated with osteosarcoma invasion. PMID: 25449781
  48. Individuals with truncating mutations in GLI2 typically present with pituitary anomalies, polydactyly and subtle facial features rather than holoprosencephaly PMID: 24744436
  49. High Gli2 expression is associated with bone destruction in lung and breast cancer. PMID: 25359619
  50. Our studies demonstrate an important role for GLI2 in Lung squamous cell carcinoma PMID: 24423612
  51. Findings indicate that Gli2 overexpression in PCa cells might support development of castration resistant PCa through AR co-activation and suggests that AR might modulate transcription from Gli2. PMID: 25132524
  52. GLI2 was correlated with lymphovascular invasion and intestinal type gastric cancer. PMID: 23371028
  53. No deletion or amplification of the entire GLI2 gene was found in a group of patients with isolated or syndrome-associated esophageal atresia. PMID: 23442119
  54. GLI2 induces genomic instability in human keratinocytes by inhibiting apoptosis. PMID: 24481442
  55. GLI2 represses E-cadherin gene (CDH1) expression in melanoma cells via distinct mechanisms, enhancing transcription of the EMT-activator ZEB1. PMID: 23890107
  56. THE MEK-RSK cascade positively regulates GLI2 stabilization and represses its degradation via inhibiting GSK-3beta-dependent phosphorylation and ubiquitination of GLI2. PMID: 23208494
  57. These findings thus identify GLI2 as a critical transcription factor antagonizing M-MITF function to promote melanoma cell phenotypic plasticity and invasive behavior. PMID: 21801332
  58. Gli2 acetylation at lysine 757 regulates hedgehog-dependent transcriptional output by preventing its promoter occupancy. PMID: 23762415
  59. A relatively high frequency of non-synonymous GLI2 variants was identified in patients with congenital growth hormone deficiency and combined pituitary hormone deficiency without other brain defects. PMID: 22967285
  60. high expression level of Gli2 was significantly associated with tumor differentiation, encapsulation, vascular invasion, early recurrence, and intra-hepatic metastasis in hepatocellular carcinoma. PMID: 23356443
  61. We show that heterozygous amino acid substitutions within GLI2 may lead to multiple piutitary hormone deficiency with mild extrapituitary findings. PMID: 23408573
  62. Transcriptional regulation of TGF-beta1 by GLI2 is a new extension to Sonic Hedgehog and TGF-beta1 cross-regulation. PMID: 22859956
  63. Mutations in GLI2 have been found in association with holoprosencephaly (HPE) and HPE-like phenotype, with and without pituitary hormone deficiencies; as well as in patients with pituitary dysfunction with and without HPE craniofacial features. PMID: 23304807
  64. The immunoexpression of Shh, Smo and Gli2 proteins was lower in Helicobacter pylori-positive group compared to Helicobacter pylori-negative group PMID: 22535603
  65. identified a GLI2 binding site within the -334/-296 region of the M-MITF promoter, critical for GLI2-driven transcriptional repression PMID: 22496449
  66. Gli2 expression in HL60 and U937 cells induced by TGF-beta is Smad3-dependent and independent of Hh receptor signaling. PMID: 22395235
  67. Novel sequence variants were found in the GLI2 gene in patients with marked involvement of the temporomandibular joint, a new clinical finding observed with mutations of this gene. PMID: 21204792
  68. data suggest that Gli2 plays a predominant role in the proliferation and apoptosis resistance of HCC cells, and that knockdown of Gli2 may be a novel anticancer strategy for the treatment of HCC PMID: 21695716
  69. This short review summarizes recent knowledge about GLI2 function and mechanisms of action downstream of TGF-beta in cancer.[Review] PMID: 21862631
  70. CCL5 signaling induces GLI2 through a PI3K-AKT-IkappaBalpha-p65 pathway and requires GLI2 transcriptional activity to modulate IL-6 expression and Ig secretion in vitro and in vivo PMID: 21454528
  71. our findings support a possible contribution of GLI2 to tardive dyskinesia susceptibility. PMID: 20939080
  72. Constitutive expression of the human hGli2 Delta N in porcine keratinocytes causes cutaneous changes not seen in the murine model. A multiple species animal model approach is needed to understand the role of Gli2 in mammalian skin. PMID: 20099029
  73. A fragment of the Hh-responsive GLI2 transcription factor directly binds and inhibits the p16 promoter and senescence is associated with the loss of nuclear GLI2. PMID: 21095584
  74. These phenotypes support partial penetrance, variable polydactyly, midline facial defects, and pituitary hormone deficiencies, including diabetes insipidus, conferred by heterozygous frameshift or nonsense GLI2 mutations. PMID: 20685856
  75. In human melanoma cells, GLI2 expression was heterogeneous, associated with loss of E-cadherin and increased in the most aggressive tumors. In this preclinical study, GLI2 was directly involved in driving melanoma invasion and metastasis. PMID: 20660365
  76. The invasiveness of human bladder TCC lines strongly correlated with expression of Gli2, a downstream mediator of Hh signaling. PMID: 20488474
  77. The finding that Gli2 co-immunoprecipitates with androgen receptor protein suggests that an interaction between these proteins might be the basis for Hedgehog/Gli support of androgen signaling PMID: 20420697
  78. Expression of SHH, GLI family zinc finger 2 (GLI2) and BMP4 mRNA and protein in the posterior wall of the terminal rectum in 40 patients with orectal malformations, were assessed. PMID: 20146882
  79. GLI2 has a role in defective anterior pituitary formation and pan-hypopituitarism, and in human head development PMID: 14581620
  80. GLI2 expression in human keratinocytes results in a marked downregulation of epidermal differentiation markers. PMID: 14691458
  81. important role for GLI2 in regulating epidermal proliferation and skin tumorigenesis. PMID: 15175043
  82. Our results establish the presence of an amino-terminal transcriptional repressor domain that plays a critical role in modulating the function of wild-type GLI2 and is essential for dominant-negative activity of a GLI2 mutant associated with human disease PMID: 15994174
  83. Higher levels of TPH2 mRNA were found throughout the entire extent of the rostrocaudal axis of the median raphe nuclei in major depression and suicide. PMID: 16192985
  84. Upregulation of largely overlapping sets of target genes was effected by both factors,GLI1 and GLI2, repression occurred predominantly in response to GLI2. PMID: 16434164
  85. Alternative splicing may be another important regulatory mechanism for the modulation of repressor and activator properties of GLI2 protein. PMID: 16553965
  86. beta-TrCP2 is a pivotal regulator of Gli2 expression and there may be an important role for posttranslational modulation of GLI2 protein levels in Hh pathway-associated human prostate cancer PMID: 16651270
  87. GLI2 plays a critical role in the malignant phenotype of prostate cancer cells PMID: 18006803
  88. Since Gli2 silencing not only downregulates cFlip, but also Bcl-2, Gli2 could be a key target for a novel therapeutic approach in basal cell carcinoma. PMID: 18264131
  89. These results reveal a key role of GLI2 in activation of the activin/BMP antagonist FST in response to hedgehog (HH) signaling. PMID: 18319260
  90. increased levels of GLI2 correlates with AI progression PMID: 18794086
  91. The stroma, in a tissue-specific manner, determines whether certain GLI2 oncogenic traits are expressed. PMID: 19015636
  92. Gli-2 rather than Gli-1 may play a pivotal role in Hedgehog signaling of endometrial carcinoma. PMID: 19432668

Show More

Hide All

Involvement in disease Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS)
Subcellular Location Nucleus, Cytoplasm, Cell projection, cilium
Protein Families GLI C2H2-type zinc-finger protein family
Tissue Specificity Expressed in breast cancers (at protein level) (PubMed:26565916). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level) (PubMed:9557682). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines (Pu
Database Links

HGNC: 4318

OMIM: 165230

KEGG: hsa:2736

STRING: 9606.ENSP00000354586

UniGene: Hs.111867

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1