Recombinant Human Zinc finger protein GLI2(GLI2),partial

Code CSB-YP009500HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P10070
Relevance Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias GLI family zinc finger protein 2 Tax helper protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Research Area Epigenetics and Nuclear Signaling
Source Yeast
Gene Names GLI2
Protein Names Recommended name: Zinc finger protein GLI2 Alternative name(s): Tax helper protein
Expression Region 412-641aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 28.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Functions as transcription regulator in the hedgehog (Hh) pathway
Involvement in disease Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS)
Subcellular Location Nucleus, Cytoplasm, Cell projection, cilium
Protein Families GLI C2H2-type zinc-finger protein family
Tissue Specificity Expressed in breast cancers (at protein level) (PubMed:26565916). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level) (PubMed:9557682). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines (Pu
Database Links

HGNC: 4318

OMIM: 165230

KEGG: hsa:2736

STRING: 9606.ENSP00000354586

UniGene: Hs.111867

Pathway Hedgehog signaling pathway
Hippo signaling pathway

Related Products

GLI2 Antibodies

GLI2 Antibodies for Homo sapiens (Human)

GLI2 Proteins

GLI2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.