Recombinant Human Zinc finger protein GLI2 (GLI2), partial

Code CSB-EP009500HU
Abbreviation Recombinant Human GLI2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
CJS; Gli 2; GLI family zinc finger 2; GLI Kruppel family member GLI2; GLI2; GLI2_HUMAN; Glioma associated oncogene family zinc finger; HPE9; Oncogene GLI2; PHS2; Tax helper protein 1; Tax helper protein 2; Tax helper protein; Tax responsive element 2 holding protein; Tax responsive element 25 bp sequence binding protein; THP; THP1; THP2; Zinc finger protein GLI2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
412-641aa
Target Protein Sequence
EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as transcription regulator in the hedgehog (Hh) pathway. Functions as transcriptional activator. May also function as transcriptional repressor. Requires STK36 for full transcriptional activator activity. Required for normal embryonic development.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Acts as a transcriptional activator in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; Acts as a transcriptional repressor.
Gene References into Functions
  1. Importantly, high expression levels of HIF-1alpha/TGF-beta2/GLI2 correlated robustly with the patient relapse following chemotherapy, highlighting a potential biomarker and therapeutic target for chemoresistance in colorectal cancer. PMID: 29891662
  2. Study found increased expression of GLI2 in osteosarcoma tissues and cell lines and determined that GLI2 is a target of miR-141-3p. PMID: 29251328
  3. In conclusion, our data suggest that overexpression of the Hedgehog components SHH, GLI2 and FOXA2 might be used as markers of an aggressive hemangioma. PMID: 28370639
  4. High GLI2 or PDGFRB expression is associated with unfavorable survival in GC patients. GLI2 can induce PDGFRB expression in GC cells via directly binding to its promoter. In addition, the GLI2-PDGFRB axis might be an important signaling pathway modulating CSC properties of GC cells. PMID: 28975979
  5. Study report that compromised CSL function depends on GLI activation for conversion of human dermal fibroblasts into CAFs, separately from cellular senescence. Decreased CSL upregulates the expression of the ULK3 kinase, which binds and activates GLI2. PMID: 28877478
  6. The authors found that hepatitis C virus derived from hepatitis C patients infected and directly induced the trans-differentiation of human primary fibroblasts into myofibroblasts, promoting fibrogenesis. This effect correlated with the activation of GLI2, one of the targets of Hedgehog signaling pathway previously reported to be involved in myofibroblast generation. PMID: 27476557
  7. role of GLI2-ABCG2 signaling axis for 5Fu resistance in gastric cancer PMID: 28847472
  8. This study showed associations of anorectal malformations with rs3738880 in GLI2 and with previous miscarriages. PMID: 28057877
  9. High GLI2 expression is associated with hepatocellular carcinoma. PMID: 27036048
  10. our findings demonstrate that multiple signaling pathways converge on Gli2 to mediate PTHrP expression and bony invasion, highlighting Gli2 as a therapeutic target to prevent bony invasion in OSCC. PMID: 27738315
  11. the effect gene of the Shh pathway, gli1, was found to have a reduced level of expression along with a decreased expression of gli2. PMID: 26446020
  12. High Gli2 expression is associated with non-small cell lung cancer. PMID: 26936993
  13. GLI2 is a dosage-sensitive gene that may be responsible for the agenesis of corpus callosum observed in the proband. PMID: 27346851
  14. Data suggest that Nrp1 (neuropilin-1) regulates Hedgehog signaling specifically at the level of activation of GLI2 transcriptional activator function; Nrp1 localization to primary cilium does not correlate with Hedgehog signal promotion. These studies were conducted in various cell types. PMID: 28667171
  15. studies identify a novel molecular mechanism of regulation of CD40L by the transcription factor GLI2 in the tumor microenvironment downstream of CCR3 signaling PMID: 28461568
  16. the data suggest that CCRK positively regulates the kinetics by which ciliary proteins such as Smoothened and Gli2 are imported into the cilium, and that the efficiency of ciliary recruitment allows for potent responses to Hedgehog signaling over long time periods. PMID: 28817564
  17. GLI2 is a regulator of beta-catenin and provides insights into its role in tumorigenesis. PMID: 28300597
  18. bioinformatics analysis and luciferase reporter assay predicted the direct binding to miR-125b-5p, which has been reported to function as a tumor suppressor in osteosarcoma. Furthermore, functional experiments validated that cir-GLI2 exerted the tumor-promoting effects on osteosarcoma cells via negatively targeting miR-125b-5p. PMID: 28695772
  19. These results demonstrate that miR-124 is an important downstream target gene of Hh signaling, and the Gli2/miR-124/AURKA axis is essential for the proliferation and growth of human glioma cells. PMID: 28393219
  20. in trophoblasts, GLI2 not only directly bound to the promoter region of gene hsd11b2 to transactivate hsd11b2 but also formed a heterodimer with RNA polymerase II, resulting in up-regulation of hsd11b2 gene transcription PMID: 27379371
  21. GLI2 was identified as a crucial downstream mediator of the pro-fibrotic effects of TGF-beta. PMID: 27793816
  22. this study shows that Gli2 expression was more often positive in advanced non-small-cell lung carcinoma patients refractory to platinum-based chemotherapy PMID: 26762562
  23. Beclin-1 acts as a tumor suppressor by regulating the hedgehog (HH) signaling pathway through Gli2 expression in gastric adenocarcinoma. PMID: 25512258
  24. Overexpression of GLI2 is associated with osteosarcoma progression. PMID: 27460090
  25. MALAT1 promotes gastric cancer proliferation and progression. MALAT1 is a direct target of miR-202 and knockdown of MALAT1 significantly decreases the expression of Gli2 by negatively regulating miR-202. PMID: 27887846
  26. the GLI2 gene may be one of the candidate genes to analyze when an association of pituitary hormone deficiency and developmental defects in posterior pituitary gland. The highly variable phenotype found suggests the presence of additional unknown factors that could contribute to the phenotype observed in these patients. PMID: 27576279
  27. the GLI2 protein level could serve as a feasible marker of ligand-dependent hedgehog activation in pancreatic neoplasms. PMID: 27543868
  28. ALDH1A1 stabilizes the Gli2 protein in an enzyme-independent manner in hepatocellular cancer. PMID: 26896768
  29. GLI2 stabilized glial cell missing-a, a pivotal transcriptional factor for trophoblastic syncytialization. PMID: 26769961
  30. The results do not support our hypothesis that common germline genetic variants in the GLI2 genes is associated with the risk of developing medulloblastoma. PMID: 26290144
  31. GLI2 mutations typically result in pituitary anomalies with or without postaxial polydactyly. PMID: 25974718
  32. Serum starvation significantly up-regulated the expression of Gli1, which in turn increased its key target cIAP2 expression and enhanced NF-kappaB/cIAP2 pathway, resulting in promoting cell survival under serum starvation PMID: 26182949
  33. the JQ1-resistant cells remain dependent on c-MYC that now becomes co-regulated by high levels of GLI2 PMID: 25807524
  34. A relatively high frequency of GLI2 mutations occur in patients with congenital growth hormone deficiency. [Review] PMID: 25878059
  35. hsa-miR-665 and hsa-miR-95 were downregulated in GSRCC but upregulated in intestinal gastric adenocarcinoma, and the relatively differential expression of the miRNAs negatively controlling their target genes, GLI2 and PLCG1 PMID: 25964059
  36. during vertebrate history GLI2 acquired a high level of complexity in the genetic mechanisms regulating its expression during spatiotemporal patterning of the central nervous system (CNS) and limbs. PMID: 25715918
  37. This family confirms the incomplete penetrance of genomic disturbances affecting the GLI2 gene. However, the family presented here is unique as none of the three identified individuals with a GLI2 deletion showed any typical signs of holoprosencephaly PMID: 25820550
  38. We genotyped the SLC6A4 5-HTTLPR (rs4795541, rs25531) and TPH2 1125A>T (rs4290270) variants and evaluated their role in moderating disulfiram treatment for cocaine dependence. PMID: 22925276
  39. miR-218 and its downstream target Gli2, as well as E-cadherin, participate in the anti-invasion process PMID: 25694126
  40. GLI2 forms part of a core HH pathway transcriptional regulatory network that promotes human myeloid leukemic progression and dormant LSC generation PMID: 25889765
  41. SPOP plays critical roles in suppressing gastric tumorigenesis through inhibiting Hh/Gli2 signaling pathway. It may provide an alternative strategy for developing therapeutic agents of gastric cancer in future. PMID: 25204354
  42. Gli2 silencing enhances TRAIL-induced apoptosis and reduces tumor growth in human hepatoma cells in vivo. PMID: 25535898
  43. results indicate that miR-202 acts as a novel tumor suppressor to regulate OS cell proliferation and apoptosis through downregulating Gli2 expression. PMID: 25156120
  44. GLI2 regulated metastasis as well as the progression of osteosarcomas. PMID: 25082385
  45. The 14-3-3zeta-driven contextual changes of Smad partners from p53 to Gli2 may serve as biomarkers and therapeutic targets of TGF-beta-mediated cancer progression PMID: 25670079
  46. Report shows that GLI2 is the novel target gene of DeltaNp63alpha and that DeltaNp63alpha-GLI2 crosstalk in osteosarcoma cells is a necessary event in osteosarcoma progression. PMID: 25085524
  47. Increased GLI2 expression is associated with osteosarcoma invasion. PMID: 25449781
  48. Individuals with truncating mutations in GLI2 typically present with pituitary anomalies, polydactyly and subtle facial features rather than holoprosencephaly PMID: 24744436
  49. High Gli2 expression is associated with bone destruction in lung and breast cancer. PMID: 25359619
  50. Our studies demonstrate an important role for GLI2 in Lung squamous cell carcinoma PMID: 24423612

Show More

Hide All

Involvement in disease
Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS)
Subcellular Location
Nucleus. Cytoplasm. Cell projection, cilium.; [Isoform 1]: Nucleus.; [Isoform 2]: Nucleus.
Protein Families
GLI C2H2-type zinc-finger protein family
Tissue Specificity
Expressed in breast cancers (at protein level). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines. Isoform 3 and isoform 4 are weakly ex
Database Links

HGNC: 4318

OMIM: 165230

KEGG: hsa:2736

STRING: 9606.ENSP00000354586

UniGene: Hs.111867

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*