Recombinant Human Zyxin (ZYX)

Code CSB-YP027165HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP027165HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP027165HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP027165HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
ZYX; Zyxin; Zyxin-2
Species
Homo sapiens (Human)
Expression Region
2-572
Target Protein Sequence
AAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVG EIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPP EEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPF SSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQ TQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEA LSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQ LTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQG QQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTS FIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCG KPLSIEADDNGCFPLDGHVLCRKCHTARAQT
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adhesion plaque protein. Binds alpha-actinin and the CRP protein. Important for targeting TES and ENA/VASP family members to focal adhesions and for the formation of actin-rich structures. May be a component of a signal transduction pathway that mediates adhesion-stimulated changes in gene expression.
Gene References into Functions
  1. Study findings identify zyxin as a physiological regulator of endothelial exocytosis through reorganizing local actin network in the final stage of exocytosis. Zyxin downregulation inhibits the secretion of VWF from human primary endothelial cells. PMID: 28256511
  2. these observations suggest that Zyxin promotes colon cancer tumorigenesis in a mitotic-phosphorylation-dependent manner and through CDK8-mediated YAP activation. PMID: 29967145
  3. Increased zyxin expression is associated with asthma. PMID: 28278518
  4. Zyxin binding to Ptc2 is due to the interaction of Zyxin 2nd LIM-domain (530-590 aa) with the under-membrane region of the cytoplasmic C-terminus of Ptc2 (1159-1412 aa). PMID: 27125030
  5. ZYX gene may be aging-related gene and involved in Osteoporosis. PMID: 25771989
  6. key regulator of stretch-induced gene expression at the cellular level PMID: 26071033
  7. Matrix density alters zyxin phosphorylation, which limits peripheral process formation and extension in endothelial cells invading 3D collagen matrices. PMID: 25038525
  8. Zyxin, which is thought to be essential for tight cell-to-cell junctions, decreased 1.8-fold in TNF-alpha-treated human brain microvascular endothelial cells. PMID: 25025691
  9. Integrin-beta5 and zyxin mediate formation of ventral stress fibers in response to transforming growth factor beta. PMID: 24036928
  10. Zyxin is a novel target for beta-amyloid peptide activities in Alzheimer's disease. PMID: 23330981
  11. Zyxin is suggested to promote growth, migration and invasiveness of fibroblastic type oral squamous cell carcinoma cells by upregulating Rac1 and Cdc42. PMID: 23292068
  12. A stretch-induced signaling pathway in vascular cells leads to the activation of zyxin, a cytoskeletal protein specifically involved in transducing mechanical stimuli. PMID: 23233529
  13. RA-induced cancer cell cytotoxicity was significantly impaired by Zyxin or PTOV1. Overall, our findings suggest that Zyxin and PTOV1 should be considered as critical determinants in cancer therapy with retinoids PMID: 23321499
  14. Zyxin is a transforming growth factor-beta (TGF-beta)/Smad3 target gene that regulates lung cancer cell motility via integrin alpha5beta1. PMID: 22778267
  15. Zyxin phenotype is mediated by partners alpha-actinin and p130Cas and ensures that motile cells in a three-dimensional matrix explore the largest space possible in minimum time. PMID: 22395610
  16. Depletion of nectin-2 from L cells expressing E-cadherin results in a loss of zyxin localization to cell-cell contacts, demonstrating that the zyxin-nectin interaction plays a critical role in zyxin targeting to these sites. PMID: 22056563
  17. LIM domain of zyxin recruits zyxin to force-bearing sites at the leading edge of migrating cells PMID: 21889443
  18. Findings suggest an unforeseen role for Zyxin in DNA damage-induced cell fate control through modulating the HIPK2-p53 signaling axis. PMID: 21248071
  19. Zyxin, whose expression is negatively regulated by microRNA-16 (miR-16), is confirmed to be a direct target gene of miR-16. Overexpression of zyxin could also restrain cell movement and enhance cell-cell adhesion. PMID: 21360639
  20. Stretch appears to be an important factor in the development of endothelial dysfunction with zyxin as a potential therapeutic target to interfere with these early changes in endothelial cell phenotype PMID: 20705921
  21. The LIM domain protein zyxin was identified as an interaction partner for human synemin. PMID: 19853601
  22. This study establishes a crucial role of zyxin in thrombin signaling in endothelial cells and provides evidence for a novel PAR-1 signaling pathway mediated by zyxin. PMID: 19690217
  23. LIM-nebulette, Lasp-1, and zyxin may play an important role in the organization of focal adhesions PMID: 15004028
  24. Within Ewing tumor cells, zyxin is expressed at very low levels and remains diffusely distributed throughout the cytoplasm, instead of concentrating in actin-rich dynamic structures. Zyxin has tumor suppressor activity in Ewing tumor cells. PMID: 15748890
  25. zyxin indirectly enables the interaction of ZNF384/CIZ/NMP4 with p130CAS PMID: 16510139
  26. A sarch for genes upregulated by thymosin beta4 identified zyxin in SiHA cells in the presence of exogenously added thymosin beta4 and when thymosin beta4 is overexpressed using adenoviral vectors. PMID: 16956606
  27. These results suggest that zyxin is involved in mechanical-force-dependent facilitation of actin polymerization at focal adhesions. PMID: 18682496
  28. We identified zyxin as an interactor with endoglin in human umbilical vein vascular endothelial cells and this interaction is localized within the 47-amino acid carboxyl-terminal cytosolic domain of endoglin, and maps within zyxin residues 326-572. PMID: 15084601

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. Cell junction, focal adhesion. Note=Associates with the actin cytoskeleton near the adhesion plaques. Enters the nucleus in the presence of HESX1.
Protein Families
Zyxin/ajuba family
Database Links

HGNC: 13200

OMIM: 602002

KEGG: hsa:7791

STRING: 9606.ENSP00000324422

UniGene: Hs.490415

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1