Recombinant Human immunodeficiency virus type 1 group M subtype K Protein Vpr(vpr)

In Stock
Code CSB-EP314796HLP
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0C1P2
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) (HIV-1)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS
Research Area Immunology
Source E.coli
Gene Names vpr
Protein Names Recommended name: Protein Vpr Alternative name(s): R ORF protein Viral protein R
Expression Region 1-96aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 18.8 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function During virus replication, may deplete host UNG protein, and incude G2-M cell cycle arrest. Acts by targeting specific host proteins for degradation by the 26S proteasome, through association with the cellular CUL4A-DDB1 E3 ligase complex by direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting that it is initiated by the VPR carried into the virion. Additionally, VPR induces apoptosis in a cell cycle dependent manner suggesting that these two effects are mechanistically linked. Detected in the serum and cerebrospinal fluid of AIDS patient, VPR may also induce cell death to bystander cells.
Subcellular Location Virion, Host nucleus, Host extracellular space
Protein Families HIV-1 VPR protein family

Related Products

vpr Antibodies

vpr Antibodies for Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) (HIV-1)

vpr Proteins

vpr Proteins for Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) (HIV-1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.