Recombinant Human mRNA export factor (RAE1)

In Stock
Code CSB-EP019276HU
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RAE1
Uniprot No.
Research Area
others
Alternative Names
dJ481F12.3; dJ800J21.1; FLJ30608; Homolog of yeast Rae1 (Bharathi) mRNA associated protein of 41 kDa (Kraemer); Homolog of yeast Rae1 mRNA associated protein of 41 kDa; MGC117333; MGC126076; MGC126077; MIG 14; MIG14; Migration inducing gene 14; Mnrp 41; Mnrp41; mRNA associated protein mrnp 41; mRNA binding protein 41 kD; mRNA export factor; mRNA export protein; mRNA-associated protein mrnp 41; MRNP 41; MRNP41; RAE 1; RAE1 (RNA export 1 S.pombe) homolog; rae1; RAE1 homolog; Rae1 protein homolog; RAE1 RNA export 1 homolog (S. pombe); RAE1 RNA export 1 homolog; RAE1L_HUMAN; RNA export 1; RNA export 1 homolog
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-368aa
Target Protein Sequence
MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
68.0kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The formation of the recombinant plasmid by incorporating the gene encoding the Human RAE1 protein (1-368aa) into a plasmid vector initiates the generation of the recombinant Human RAE1 protein. Transforming the recombinant plasmid into e.coli cells and then selecting the positive e.coli cells based on their ability to survive in the presence of a specific antibiotic. The positive e.coli cells are cultured under conditions that stimulate the expression of the gene of interest. The protein is equipped with a N-terminal GST tag. After expression, affinity purification is employed to isolate and purify the recombinant Human RAE1 protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human RAE1 protein, revealing a purity level exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in mitotic bipolar spindle formation. Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.
Gene References into Functions
  1. RAE1 overexpression was associated with considerably poorer disease-free survival and distant metastasis-free survival, especially in patients with oestrogen receptor-positive tumours. PMID: 28181567
  2. show that USP11 is associated with the mitotic spindle, does not regulate SAC inactivation, but controls ubiquitination of RAE1 at the mitotic spindle, hereby functionally modulating its interaction with Nuclear Mitotic Apparatus protein (NuMA). PMID: 29293652
  3. Nuclear export inhibition by ORF10 of human herpesvirus 8 requires an interaction with an RNA export factor, Rae1. PMID: 27832591
  4. After PSK administration, INF-g production in CD8(+) T cells increased in mice with cells expressing neither Rae-1 nor H60, but did not change in mice implanted with cells expressing both Rae-1 and H60. We demonstrated that the expression of NKG2DLs affects tumor immunity and the efficacy of immuno therapy in tumor-bearing mouse model PMID: 28739693
  5. Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 * Nup98). PMID: 24927547
  6. vesicular stomatitis virus M protein interacted efficiently with Rae1-Nup98 complexes associated with the chromatin fraction of host nuclei, consistent with an effect on host transcription PMID: 23028327
  7. mouse cytomegalovirus m152/gp40 interaction with RAE1gamma structural analysis reveals a paradigm for MHC/MHC interaction in immune evasion PMID: 23169621
  8. This study established a novel postmitotic function for rae-1 in neuronal development. PMID: 22357847
  9. RAE1 transgene orchestrates proper chromosome segregation and NUP98-mediated leukemogenesis. PMID: 21467841
  10. In a transgenic mouse model of chronic natural killer NKG2D ligand expression, constant exposure to NKG2D ligand RNA export 1 homolog (Rae-1 epsilon) does not functionally impair NK cells or CD8-positive T cells in the context of viral infection. PMID: 20530257
  11. present the crystal structure of human Rae1 in complex with the Gle2-binding sequence (GLEBS) of Nup98 at 1.65 A resolution. Rae1 forms a seven-bladed beta-propeller with several extensive surface loops. PMID: 20498086
  12. These data show an association of mrnp41 with MT and, moreover, demonstrate that an intact MT system is necessary for dispersion of mrnp41-containing particles to the cellular periphery PMID: 11831386
  13. VSV M protein blocks mRNA export by disrupting Rae1 function, which can be reverted by induction of Rae1 expression. PMID: 15629720
  14. A purified Rae1 complex stabilizes microtubules in egg extracts in a RanGTP/importin beta-regulated manner PMID: 15851029
  15. point to the Rae1-NuMA interaction as a critical element for normal spindle formation in mitosis PMID: 17172455
  16. Retinoic acid downregulates Rae1 leading to APC(Cdh1) activation and neuroblastoma SH-SY5Y differentiation. PMID: 18212744

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, spindle pole.
Protein Families
WD repeat rae1 family
Database Links

HGNC: 9828

OMIM: 603343

KEGG: hsa:8480

STRING: 9606.ENSP00000360286

UniGene: Hs.371698

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*