Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SNCA

Uniprot No.

P61142

Research Area

Others

Alternative Names

SNCA; Alpha-synuclein

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Yeast

Expression Region

1-140aa

Target Protein Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

16.5kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The DNA fragment encoding the 1-140aa of the Macaca fascicularis SNCA protein was fused with N-terminal 6xHis tag gene and then was inserted into the expression vector, which was subsequently transfected into the yeast cells for expression. The resulting product was further purified to obtain the recombinant Macaca fascicularis SNCA protein. The purity of this recombinant SNCA protein is greater than 90% assessed by Bandscan software analysis combined with SDS-PAGE. This recombinant SNCA protein showed a band on the gel with a molecular weight of approximately 17 kDa.

In light of recent discoveries, researchers demonstrated that genetic triplication of the SNCA locus causes Parkinson disease. Another evidence discovered that the inhibition of SNCA enhances α‐synuclein in Parkinson's disease. SNCA is determined as one of susceptibility genes for Parkinson's disease. Albeit less is known about the mechanism of SNCA, SNCA is widely found to manipulate the mobility of synaptic vesicles. This regulation process is possible to disrupt the synaptic vesicle recycling and neurotransmitter release.

Target Background

Function

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Plays also a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity.

Gene References into Functions

Study shows that the age-dependent alpha-syn accumulation is correlated with an elevation of TRPC3 in the mitochondrial fractions isolated from monkey and mouse brains. In animal and cell models, alpha-syn overexpression was accompanied by an elevation of alpha-syn and TRPC3 in the mitochondrial fractions, and alpha-syn downregulation was associated with a reduction of the mitochondrial alpha-syn and TRPC3. PMID: 27904950

Subcellular Location

Cytoplasm. Membrane. Nucleus. Cell junction, synapse. Secreted.

Protein Families

Synuclein family

Database Links

KEGG: mcf:102119369

Code	CSB-YP021912MOV
Abbreviation	Recombinant Cynomolgus monkey SNCA protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Alpha-synuclein (SNCA)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage