Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC50 is 1.292-1.518 ng/mL.

Target Names

GLP1R

Uniprot No.

F8V479

Alternative Names

Glucagon-like peptide 1 receptor; GLP1R

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

24-144aa

Target Protein Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERNSPEEQLLSL

Mol. Weight

15.5 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

GLP-1 receptor signaling plays a central role in glucose homeostasis and cardiovascular protection, making the extracellular domain a critical target for therapeutic antibody development and small-molecule screening. This mammalian-expressed fragment spanning residues 24–144 captures the ligand-binding domain and demonstrates quantifiable antibody recognition in functional ELISA, with an EC50 of 1.292–1.518 ng/mL when binding a recombinant anti-GLP1R antibody at 2 μg/mL immobilization. The cynomolgus macaque ortholog enables direct translatability to preclinical primate models, supporting competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening where native glycosylation and disulfide architecture are essential for physiological binding kinetics. Purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in surface plasmon resonance affinity characterization and biolayer interferometry experiments requiring low background interference.

Code	CSB-MP4826MOV
Abbreviation	Recombinant Cynomolgus monkey GLP1R protein, partial (Active)
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GLP1R at 2 μg/ml can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA2HU). The EC₅₀ is 1.292-1.518 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Glucagon-like peptide 1 receptor (GLP1R), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage