Recombinant Macaca fascicularis Nectin cell adhesion molecule 2 (NECTIN2), partial (Active)

In Stock
Code CSB-MP5776MOV
Abbreviation Recombinant Cynomolgus monkey NECTIN2 protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis NECTIN2 at 2 μg/ml can bind Anti-NECTIN2 recombinant antibody(CSB-RA835690MA1HU). The EC50 is 1.011-1.193 ng/mL. Biological Activity Assay
  • The purity of NECTIN2 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis NECTIN2 at 2 μg/mL can bind Anti-NECTIN2 recombinant antibody(CSB-RA835690MA1HU). The EC50 is 1.011-1.193 ng/mL.
Target Names
Uniprot No.
Alternative Names
Nectin cell adhesion molecule 2; NECTIN2
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
32-360aa
Target Protein Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSQRLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Mol. Weight
36.9 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

NECTIN2 is a cell-adhesion molecule involved in cell-cell interactions, making its functional characterization critical for studying intercellular communication and adhesion-related signaling pathways. This recombinant Macaca fascicularis Nectin cell adhesion molecule 2 (NECTIN2), partial (Active) (CSB-MP5776MOV) is a mammalian cell-expressed protein spanning amino acids 32–360, featuring a C-terminal 10xHis-tag for purification and detection, with a molecular weight of 36.9 kDa. Functional activity is demonstrated by its binding ability in a functional ELISA, where immobilized Macaca fascicularis NECTIN2 at 2 μg/mL binds the Anti-NECTIN2 recombinant antibody (CSB-RA835690MA1HU) with an EC50 of 1.011–1.193 ng/mL, confirming specific interaction. Purity exceeds 95% as determined by both SDS-PAGE (Tris-Glycine discontinuous reduced gel with 5% enrichment and 15% separation) and SEC-HPLC, while endotoxin levels are below 1.0 EU/μg (measured by the LAL method). These attributes support its use in cell-adhesion mechanism studies, related signaling pathway investigations, antibody binding assays, and as a tool for exploring NECTIN2-mediated intercellular interactions. The high purity, low endotoxin, and His-tag facilitate reliable quantification and integration into various biochemical and cell-based workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*