Recombinant Macaca fascicularis Serine/threonine-protein kinase receptor (ACVRL1), partial (Active)

In Stock
Code CSB-BP5806MOV
Abbreviation Recombinant Cynomolgus monkey ACVRL1 protein, partial (Active)
MSDS
Size $472
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis ACVRL1 at 2 μg/ml can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU). The EC50 is 6.893-8.194 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU). The EC50 is 6.893-8.194 ng/mL.
Target Names
Uniprot No.
Alternative Names
Serine/threonine-protein kinase receptor; EC:2.7.11.30; ACVRL1
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Baculovirus
Expression Region
22-118aa
Target Protein Sequence
DPVKPSRGPLVTCTCESPHCRGPTCQGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNRNVSLVLEATQTPSEQPGTDSQ
Mol. Weight
11.59kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

ACVRL1, a type I receptor in the TGF-β superfamily, plays a critical role in angiogenesis and vascular remodeling, making it a target of interest in cancer research where aberrant signaling contributes to tumor vasculature development. This partial extracellular domain construct spanning residues 22–118 demonstrates quantifiable antibody-binding activity in functional ELISA, with an EC50 of 6.893–8.194 ng/mL when immobilized at 2 μg/mL and challenged with anti-ACVRL1 recombinant antibody, confirming proper epitope presentation. The validated binding kinetics support use in therapeutic antibody epitope mapping, competitive inhibition screening to identify blocking candidates, and ligand-receptor interaction assays including ELISA and surface plasmon resonance. Produced in baculovirus with greater than 95% purity and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for antibody development workflows and provides a suitable positive control for binding assays targeting the ACVRL1 extracellular region.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*