Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis ACVRL1 at 2 μg/mL can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU). The EC50 is 6.893-8.194 ng/mL.

Target Names

ACVRL1

Uniprot No.

A0A2K5WXU2

Alternative Names

Serine/threonine-protein kinase receptor; EC:2.7.11.30; ACVRL1

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Baculovirus

Expression Region

22-118aa

Target Protein Sequence

DPVKPSRGPLVTCTCESPHCRGPTCQGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNRNVSLVLEATQTPSEQPGTDSQ

Mol. Weight

11.59kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

ACVRL1, a type I receptor in the TGF-β superfamily, plays a critical role in angiogenesis and vascular remodeling, making it a target of interest in cancer research where aberrant signaling contributes to tumor vasculature development. This partial extracellular domain construct spanning residues 22–118 demonstrates quantifiable antibody-binding activity in functional ELISA, with an EC50 of 6.893–8.194 ng/mL when immobilized at 2 μg/mL and challenged with anti-ACVRL1 recombinant antibody, confirming proper epitope presentation. The validated binding kinetics support use in therapeutic antibody epitope mapping, competitive inhibition screening to identify blocking candidates, and ligand-receptor interaction assays including ELISA and surface plasmon resonance. Produced in baculovirus with greater than 95% purity and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for antibody development workflows and provides a suitable positive control for binding assays targeting the ACVRL1 extracellular region.

Code	CSB-BP5806MOV
Abbreviation	Recombinant Cynomolgus monkey ACVRL1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$472
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis ACVRL1 at 2 μg/ml can bind Anti-ACVRL1 recombinant antibody(CSB-RA001262MA1HU). The EC₅₀ is 6.893-8.194 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Serine/threonine-protein kinase receptor (ACVRL1), partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage