Recombinant Macaca fascicularis TNF superfamily member 13b (TNFSF13B), partial (Active)

In Stock
Code CSB-MP6724MOV
Abbreviation Recombinant Cynomolgus monkey TNFSF13B protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B(CSB-MP6427MOV) at 2 μg/ml can bind Macaca fascicularis TNFSF13B protein. The EC50 is 7.254-13.83 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B(CSB-MP6427MOV) at 2 μg/mL can bind Macaca fascicularis TNFSF13B protein. The EC50 is 7.254-13.83 ng/mL.
Target Names
Uniprot No.
Alternative Names
TNF superfamily member 13b; TNFSF13B
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
141-285aa
Target Protein Sequence
TVIQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Mol. Weight
42.4 kDa
Protein Length
Partial
Tag Info
N-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TNFSF13B (BAFF) regulates B-cell survival and maturation through TNFRSF13B (TACI) and related receptors, making it a critical target in autoimmunity and B-cell malignancy research. This cynomolgus macaque ortholog, spanning residues 141–285 of the mature extracellular domain, demonstrates robust receptor engagement with an EC50 of 7.3–13.8 ng/mL in functional ELISA against immobilized TNFRSF13B, providing a quantitative benchmark for dose selection in B-cell proliferation assays, NF-κB activation studies, and antibody class-switching experiments. The endotoxin level below 1.0 EU/μg prevents LPS-driven artifacts in primary B-cell and PBMC cultures, where even trace contamination can confound cytokine-specific responses. Purity exceeding 90% by SDS-PAGE, combined with the validated receptor-binding activity, supports use as a positive control in ELISA-based cytokine detection platforms and as a reference standard for evaluating anti-BAFF therapeutic candidates in preclinical cynomolgus models of lupus or lymphoma.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*