Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B(CSB-MP6427MOV) at 2 μg/mL can bind Macaca fascicularis TNFSF13B protein. The EC50 is 7.254-13.83 ng/mL.

Target Names

TNFSF13B

Uniprot No.

A0A2K5V2X4

Alternative Names

TNF superfamily member 13b; TNFSF13B

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

141-285aa

Target Protein Sequence

TVIQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Mol. Weight

42.4 kDa

Protein Length

Partial

Tag Info

N-terminal hFc1-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

TNFSF13B (BAFF) regulates B-cell survival and maturation through TNFRSF13B (TACI) and related receptors, making it a critical target in autoimmunity and B-cell malignancy research. This cynomolgus macaque ortholog, spanning residues 141–285 of the mature extracellular domain, demonstrates robust receptor engagement with an EC50 of 7.3–13.8 ng/mL in functional ELISA against immobilized TNFRSF13B, providing a quantitative benchmark for dose selection in B-cell proliferation assays, NF-κB activation studies, and antibody class-switching experiments. The endotoxin level below 1.0 EU/μg prevents LPS-driven artifacts in primary B-cell and PBMC cultures, where even trace contamination can confound cytokine-specific responses. Purity exceeding 90% by SDS-PAGE, combined with the validated receptor-binding activity, supports use as a positive control in ELISA-based cytokine detection platforms and as a reference standard for evaluating anti-BAFF therapeutic candidates in preclinical cynomolgus models of lupus or lymphoma.

Code	CSB-MP6724MOV
Abbreviation	Recombinant Cynomolgus monkey TNFSF13B protein, partial (Active)
MSDS	MSDS Datasheet
Size	$118
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B(CSB-MP6427MOV) at 2 μg/ml can bind Macaca fascicularis TNFSF13B protein. The EC₅₀ is 7.254-13.83 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis TNF superfamily member 13b (TNFSF13B), partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage