Recombinant Macaca fascicularis Transthyretin(TTR)

In Stock
Code CSB-MP025270MOV
Size US$3696 How to order?
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP025270MOV could indicate that this peptide derived from Mammalian Cell-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) TTR.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP025270MOV could indicate that this peptide derived from Mammalian Cell-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) TTR.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names TTR
Uniprot No. Q8HXW1
Research Area Cardiovascular
Alternative Names TTR; QccE-10711; QccE-14396; Transthyretin; Prealbumin
Species Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source Mammalian cell
Expression Region 21-147aa
Target Protein Sequence GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 17.7kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Subcellular Location Secreted.
Protein Families Transthyretin family
Database Links

KEGG: mcf:101864775

UniGene: Mfa.4636

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1