Recombinant Macaca fascicularis Transthyretin (TTR)

In Stock
Code CSB-EP025270MOV
Abbreviation Recombinant Cynomolgus monkey TTR protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
TTR; QccE-10711; QccE-14396; Transthyretin; Prealbumin
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
E.coli
Expression Region
21-147aa
Target Protein Sequence
GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The target gene is synthesized by fusing the 6xHis tag gene to the N-terminus of the gene fragment that codes for the mature human TTR antigen covering amino acids 21-147. This target gene undergoes PCR amplification and is cloned into expression vectors to create recombinant plasmids. The plasmids are then introduced into E. coli cells, which are cultured to enable protein expression. The supernatant is collected and purified through affinity chromatography, producing recombinant human TTR protein with a purity level above 90%, as demonstrated by SDS-PAGE.

Macaca fascicularis is a non-human primate species widely utilized in biomedical research due to its physiological and genetic similarities to humans. One notable area of research involves transthyretin (TTR), a protein that plays a crucial role in the transport of thyroid hormones and retinol-binding protein in the bloodstream.

TTR is particularly significant in the context of amyloidosis. Studies have shown that TTR can misfold and aggregate, resulting in amyloid fibril formation, which is implicated in hereditary transthyretin amyloidosis (ATTR) [1]. The Macaca fascicularis serves as a valuable model for studying this condition, as it shares similar physiological responses to TTR-related diseases as humans [1].

Research involving Macaca fascicularis has demonstrated the expression and localization of TTR in various tissues, contributing to a better understanding of its role in health and disease. For instance, while the expression of TTR in peripheral blood mononuclear cells has been studied, the specific regulatory functions during different physiological states require further investigation [2]. Furthermore, the genetic makeup of Macaca fascicularis has been sequenced, providing insights into the TTR gene and its variants, which can influence susceptibility to amyloid diseases [3].

References:
[1] K. Murakami, N. Izuo, & G. Bitan, Aptamers targeting amyloidogenic proteins and their emerging role in neurodegenerative diseases, Journal of Biological Chemistry, vol. 298, no. 1, p. 101478, 2022. https://doi.org/10.1016/j.jbc.2021.101478
[2] J. Xu, Y. Xu, B. Miao, M. Deng, Y. Wang, P. Xiang, et al., Influence of menstrual cycle on the expression of clock genes in peripheral blood mononuclear cells in macaca fascicularis, European Journal of Obstetrics & Gynecology and Reproductive Biology, vol. 186, p. 54-58, 2015. https://doi.org/10.1016/j.ejogrb.2015.01.003
[3] T. Tan, L. Xia, K. Tu, J. Tang, S. Yin, L. Dai, et al., Improved macaca fascicularis gene annotation reveals evolution of gene expression profiles in multiple tissues, BMC Genomics, vol. 19, no. 1, 2018. https://doi.org/10.1186/s12864-018-5183-y

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you please tell me what the concentration of item CSB-EP025270MOV is?

A:
CSB-EP025270MOV-100ug is from Lot 03772. The protein concentration is about 0.5mg/ml.
In order to maintain stability, our current stock proteins are basically stored in lyophilized form in the warehouse.
For CSB-EP025270MOV-100ug, we send liquid form because your order size does not match with our stock size, besides Lot 03772, we also have a sufficient amount of lyophilized powder stock.
If the customer has specified protein concentration, we can reconstitute it to the concentration required by the customer.

Target Background

Function
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Subcellular Location
Secreted.
Protein Families
Transthyretin family
Database Links

KEGG: mcf:101864775

UniGene: Mfa.4636

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*