Recombinant Macaca fascicularis Transthyretin(TTR)

In Stock
Code CSB-MP025270MOV
Product Type Recombinant Protein
Size US$1232Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q8HXW1
Relevance Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP025270MOV could indicate that this peptide derived from Mammalian Cell-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) TTR.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP025270MOV could indicate that this peptide derived from Mammalian Cell-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) TTR.
Storage Buffer Tris-based buffer,50% glycerol
Alias Prealbumin
Species Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE
Research Area Cardiovascular
Source Mammalian cell
Gene Names TTR
Expression Region 21-147aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 17.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
Subcellular Location Secreted
Protein Families Transthyretin family
Database Links

KEGG: mcf:101864775

UniGene: Mfa.4636

Pathway Th17 cell differentiation
Thyroid hormone synthesis

Related Products

TTR Antibodies

TTR Antibodies for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

TTR Proteins

TTR Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.