Recombinant Macaca mulatta Interleukin-6 receptor subunit alpha (IL6R), Partial (Active)

In Stock
Code CSB-MP5215MOW
Abbreviation Recombinant Rhesus macaque IL6R protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/ml can bind Anti-IL6R recombinant antibody (CSB-RA011665MA1HU). The EC50 is 26.59-31.72 ng/mL. Biological Activity Assay
  • Activity
    IL6R Recombinant Monoclonal Antibody (CSB-RA011665MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
  • The purity of IL6R was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/mL can bind Anti-IL6R recombinant antibody (CSB-RA011665MA1HU). The EC50 is 26.59-31.72 ng/mL.
②IL6R Recombinant Monoclonal Antibody (CSB-RA011665MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
Uniprot No.
Alternative Names
Interleukin-6 receptor subunit alpha; IL-6R 1
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
20-365aa
Target Protein Sequence
LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP
Mol. Weight
39.5 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

IL-6 receptor alpha mediates the pleiotropic signaling of interleukin-6 in inflammation, immune regulation, and oncogenesis, making it a validated target for therapeutic intervention in cancer and autoimmune disease. This recombinant protein, spanning residues 20–365 and expressed in mammalian cells to preserve native glycosylation and folding, demonstrates robust binding to an anti-IL6R monoclonal antibody with a sub-nanomolar affinity constant of 0.381 nM as measured by surface plasmon resonance, confirming conformational integrity of the extracellular ligand-binding domain. Functional ELISA validation shows an EC50 of 26.59–31.72 ng/mL, providing quantitative benchmarks for competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening workflows. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for SPR-based affinity characterization, biolayer interferometry studies, and small-molecule inhibitor screening in drug discovery programs targeting IL-6 signaling pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*