Purity

≥ 95% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/mL can bind Anti-IL6R recombinant antibody (CSB-RA011665MA1HU). The EC50 is 26.59-31.72 ng/mL.
②IL6R Recombinant Monoclonal Antibody (CSB-RA011665MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay (WeSPRTM 200).

Target Names

IL6R

Uniprot No.

A0A5F8AUE5

Alternative Names

Interleukin-6 receptor subunit alpha; IL-6R 1

Species

Macaca mulatta (Rhesus macaque)

Source

Mammalian cell

Expression Region

20-365aa

Target Protein Sequence

LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP

Mol. Weight

39.5 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

IL-6 receptor alpha mediates the pleiotropic signaling of interleukin-6 in inflammation, immune regulation, and oncogenesis, making it a validated target for therapeutic intervention in cancer and autoimmune disease. This recombinant protein, spanning residues 20–365 and expressed in mammalian cells to preserve native glycosylation and folding, demonstrates robust binding to an anti-IL6R monoclonal antibody with a sub-nanomolar affinity constant of 0.381 nM as measured by surface plasmon resonance, confirming conformational integrity of the extracellular ligand-binding domain. Functional ELISA validation shows an EC50 of 26.59–31.72 ng/mL, providing quantitative benchmarks for competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening workflows. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for SPR-based affinity characterization, biolayer interferometry studies, and small-molecule inhibitor screening in drug discovery programs targeting IL-6 signaling pathways.

Code	CSB-MP5215MOW
Abbreviation	Recombinant Rhesus macaque IL6R protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/ml can bind Anti-IL6R recombinant antibody (CSB-RA011665MA1HU). The EC₅₀ is 26.59-31.72 ng/mL. Biological Activity Assay Activity IL6R Recombinant Monoclonal Antibody (CSB-RA011665MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay The purity of IL6R was greater than 90% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca mulatta Interleukin-6 receptor subunit alpha (IL6R), Partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage