Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis F3 at 2 μg/mL can bind Anti-F3 recombinant antibody (CSB-RA007928MA2HU). The EC50 is 0.4495-0.5538 ng/mL.

Target Names

F3

Uniprot No.

A0A2K5VX02

Alternative Names

Tissue factor; Coagulation factor III; F3

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

33-252aa

Target Protein Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQISTKSGDWKSKCFYTADTECDLTDEIVKDVKQTYLARVFSYPAGHVESTGSTEEPPYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVQDEWTLVRRNDTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRRTANRKSTDSPVECMGHEKGESRE

Mol. Weight

26.4 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Tissue factor initiates the extrinsic coagulation cascade upon binding factor VIIa, making it a critical target for thrombosis research and anticoagulant therapeutic development. This cynomolgus macaque ortholog, spanning residues 33–252 to capture the complete extracellular domain, demonstrates quantifiable antibody-binding activity with an EC50 of 0.45–0.55 ng/mL in functional ELISA, confirming proper epitope presentation for therapeutic antibody screening and epitope mapping studies. Mammalian expression preserves the native glycosylation and disulfide architecture essential for physiologically relevant ligand interactions, supporting competitive inhibition assays and small-molecule inhibitor screening in drug discovery workflows. The protein meets the quality thresholds commonly required for surface plasmon resonance and biolayer interferometry affinity characterization, with purity exceeding 95% and endotoxin below 1.0 EU/μg, providing a suitable basis for binding kinetics studies and positive control applications in coagulation pathway investigations.

Code	CSB-MP6582MOV
Abbreviation	Recombinant Cynomolgus monkey F3 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$190
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis F3 at 2 μg/ml can bind Anti-F3 recombinant antibody (CSB-RA007928MA2HU). The EC₅₀ is 0.4495-0.5538 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Tissue factor (F3), partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage