Recombinant Macaca mulatta Chemokine CCL20/MIP-3ALPHA(CCL20)

Code CSB-EP004784MOWe0
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q8HYP6
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM
Research Area Others
Source E.coli
Expression Region 27-96aa
Tag Info N-terminal GST-tagged
Mol. Weight 35.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Antibodies

Antibodies for Macaca mulatta (Rhesus macaque)

Proteins

Proteins for

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.