Your Good Partner in Biology Research
Tel : 301-363-4651
CD47｜Proteinase K｜EGFR｜BCMA｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits
Your Good Partner in Biology Research
CD47｜Proteinase K｜EGFR｜BCMA｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits
| Code | CSB-YP008434MOW |
| Size | Pls inquire |
| Source | Yeast |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP008434MOW |
| Size | Pls inquire |
| Source | E.coli |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP008434MOW-B |
| Size | Pls inquire |
| Source | E.coli |
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-BP008434MOW |
| Size | Pls inquire |
| Source | Baculovirus |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-MP008434MOW |
| Size | Pls inquire |
| Source | Mammalian cell |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | >85% (SDS-PAGE) |
| Target Names | FASLG |
| Uniprot No. | P63307 |
| Alternative Names | FASLG; CD95L; FASL; TNFSF6; Tumor necrosis factor ligand superfamily member 6; CD95 ligand; CD95-L; Fas antigen ligand; Fas ligand; FasL; CD antigen CD178) [Cleaved into: Tumor necrosis factor ligand superfamily member 6; membrane form; Tumor necrosis factor ligand superfamily member 6; soluble form; Receptor-binding FasL ectodomain; Soluble Fas ligand; sFasL); ADAM10-processed FasL form; APL); FasL intracellular domain; FasL ICD; SPPL2A-processed FasL form; SPA)] |
| Species | Macaca mulatta (Rhesus macaque) |
| Expression Region | 102-280 |
| Target Protein Sequence | QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEW EDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDL VMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Protein Length | Partial |
| Tag Info | The following tags are available. N-terminal His-tagged Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
| Form | Lyophilized powder |
| Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
| Function | Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells contributing to the termination of immune responses. TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance. Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis. |
| Gene References into Functions |
|
| Subcellular Location | Cell membrane, Single-pass type II membrane protein, Cytoplasmic vesicle lumen, Lysosome lumen, Note=Colocalizes with the SPPL2A protease at the cell membrane, Is internalized into multivesicular bodies of secretory lysosomes after phosphorylation by FGR and monoubiquitination, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 6, soluble form: Secreted, Note=May be released into the extracellular fluid by cleavage from the cell surface, SUBCELLULAR LOCATION: FasL intracellular domain: Nucleus |
| Protein Families | Tumor necrosis factor family |
| Database Links |
KEGG: mcc:574159 STRING: 9544.ENSMMUP00000009553 UniGene: Mmu.3579 |
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide
