Recombinant Mouse Insulin-1 (Ins1)

In Stock
Code CSB-YP355623MO
Abbreviation Recombinant Mouse Ins1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Ins1
Uniprot No.
Research Area
others
Alternative Names
Ins1; Ins-1; Insulin-1 [Cleaved into: Insulin-1 B chain; Insulin-1 A chain]
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
25-108aa
Target Protein Sequence
FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Has CSB-YP355623MO been tested in cell culture?

A:
Thanks for your inquiry.
We haven't tested this protein in cell culture.
Q:

I have some problems in the development of the immunoassay to detect mouse insulin. Our antibodies are produced against recombinant human insulin, but they also react with mouse insulin (affinity tested). However, once I perform the immunoassay I could not see any specific signal, all signal is like background noise. I¡¯m not sure if either insulin or one of the antibodies is not working. However, I have some questions regarding recombinant mouse insulin that I hope you could answer,
Insulin purity was assessed by SDS-PAGE, addressing 85 % of purity, I don¡¯t understand why stained gel only shows one single band, theoretically there are other proteins/peptides, which could show more other bands in SDS-PAGE, right? . In this sense, if insulin expected band should be at 13 kDa (in you datasheet), why stained gel shows a single band at 21 kDa. I guess that this insulin is suitable as a standard/calibrator for immunoassays development, right? (Of course, always depending on the antibodies used).

A:
Thanks for your inquiry.
1.Our QC standard is over 85%,you can see from the COA that the purity is 90%, the MW in theory is 13kDa, the observed MW is 21kDa. The reason is because the yeast recombinant expression have extra galactosylated modification (mainly N-type high mannose modification). We have write the reason of the difference on the COA.
2.It can be used as the Elisa standard, but need a correct matched antibody,
① species of origin, the protein mouse and human sequence similarity is 81% is not very high, we are not 100% confirm it can be used cross-reaction
②The source of the immunogen is also important, the immunogen and the detection of the protein is best from the same expression system, we have encountered several times, that different systems expressed protein and antibody binding reaction is not the same.
We also have the antibody of human species (CSB-PA3589A0Rb), and have CSB-YP355623MO with the same batch in stock, while the E.coil system expression (CSB-EP355623MO) also have in stock. We are preparing do the WB test, we will send you the results once we get it.

Target Background

Function
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Gene References into Functions
  1. Impairment in the insulin-Snail1 axis may contribute to non-alcoholic fatty liver disease in obesity. PMID: 30013137
  2. Feeding of high fat diet leads to impairment of brain insulin signaling linked with neuroinflammation. Insulin resistance due to high fat diet associated with biochemical changes in markers related with Alzheimer disease pathology. PMID: 27771511
  3. High INS1 expression is associated with weight gain and obesity. PMID: 29122848
  4. psychological stress impairs insulin signaling and results in hippocampal deficits. PMID: 29970188
  5. Our data shed light on the putative role of Kv1.3 in weight gain and insulin-dependent responses contributing to knowledge about adipocyte physiology. PMID: 29947924
  6. Data suggest that hybrid insulin peptides (HIPs), formed in insulin-secreting-cells by fusion of insulin C-peptide fragments to peptide fragments of chromogranin A or islet amyloid polypeptide, and reactivity of CD4+-T-lymphocytes to HIPs may act as biomarkers of autoimmunity in type 1 diabetes. PMID: 29976617
  7. Our findings, focusing on energy balance, provide a mechanistic understanding of the promising effect of early insulin initiation on lipotoxicity. Insulin, by recovering UCP3 activity, alleviated energy surfeit and potentiated AMPK-mediated lipid homeostasis in skeletal muscle cells following exposure to PA and in gastrocnemius of mice fed HFD. PMID: 29039450
  8. In the present study, the mRNA expression of the two mouse insulin genes Ins1 and Ins2 was investigated in MIN6 cells treated with different concentrations of melatonin, and insulin secretion was detected under the same conditions. Following the overexpression or silencing of MTNR1B, the activities of components of the MAPK signaling pathway PMID: 29207116
  9. diabetic gastroparesis was an aggressive process due to the successive damages of myenteric cholinergic neurones and ICC by impairing the insulin/InsR and IGF-1/IGF-1R signaling. Insulin therapy in the early stage may delay diabetic gastroparesis PMID: 28931726
  10. nNOS mediates insulin- and oxidative stress-induced glucose uptake in skeletal muscle myotubes. PMID: 28666850
  11. Data (including data from studies using knockout mice) suggest that Ins1 and Ins2 are required for pancreatic beta-cell maturation; thus, Ins1 and Ins2 are needed for normal beta-cell development and for maintenance of normal beta-cell function. PMID: 29029025
  12. Despite higher endogenous insulin concentrations following feeding, arcuate nucleus phosphorylation of Akt (pAkt) levels were significantly lower in the pregnant group compared with the nonpregnant group. PMID: 29029017
  13. Our current results reinforce the notion that the AT2R has a physiological role in the conservation of insulin action PMID: 27979738
  14. E4-ORF1 activation of PI3K in adipocytes recapitulates insulin regulation of FoxO1 but not regulation of Glut4. This uncoupling of PI3K effects occurs despite E4-ORF1 activating PI3K and downstream signaling to levels achieved by insulin PMID: 28009298
  15. These data support a role for islet NGF in fine-tuning insulin secretion. PMID: 27424144
  16. PDX1 and ISL1 regulation of insulin gene expression in pancreatic beta cells, was investigated. PMID: 26994512
  17. insulin and aPC converge on a common spliced-X-box binding protein-1 (sXBP1) signaling pathway to maintain endoplasmic reticulum (ER) homeostasis. PMID: 28687614
  18. Insulin stimulation of Akt1 and Akt2 signaling in Cystic fibrosis airway cells was diminished compared with that observed in airway cells expressing wild-type CFTR. PMID: 28213469
  19. These data implicate the insulin-FoxM1/PLK1/CENP-A pathway-regulated mitotic cell-cycle progression as an essential component in the beta cell adaptation to delay and/or prevent progression to diabetes. PMID: 28286049
  20. Rac1 activation is caused by membrane translocation of a guanine nucleotide exchange factor FLJ00068 in Akt2-mediated insulin signaling in mouse skeletal muscle. PMID: 27163697
  21. Netrin-1 enhanced insulin secretion by promoting beta-cell Ca(2+) influx and cAMP production. PMID: 27520508
  22. This study identifies AR as a novel receptor that enhances beta cell function. PMID: 27133133
  23. The effects were abolished by using pharmacological inhibition of PI3K/Akt with LY294002 and paralleled by transfecting DCs with klotho siRNA. In conclusion, the regulation of klotho sensitive DC function by IGF-1 or insulin is mediated through PI3K/Akt signaling pathway in BMDCs. PMID: 27808000
  24. Overexpression of either ca-Nfatc2 or ca-Nfatc1 in mouse islets enhanced insulin secretion, whereas only ca-Nfatc2 was able to promote b-cell proliferation, suggesting distinct molecular pathways mediating insulin secretion vs. b-cell proliferation are regulated by NFAT PMID: 27935966
  25. BMP-7 therefore is an attractive candidate for tackling a multifaceted disease such as diabetes, since it not only reduces body fat, but also strengthens insulin signaling, causing improved glucose uptake and ameliorating peripheral insulin resistance. PMID: 28186649
  26. these findings demonstrate, for the first time, that miR-155 is a positive regulator of insulin sensitivity with potential applications for diabetes treatment. PMID: 27711113
  27. Maternal chromium restriction leads to glucose metabolism imbalance in mice offspring through insulin signaling and Wnt signaling pathways. PMID: 27782077
  28. Hyperglycemia and hyperlipidemia blunts the Insulin-Inpp5f negative feedback loop in the diabetic heart. PMID: 26908121
  29. Data suggest that resveratrol acts on differentiating preadipocytes by inhibiting insulin signaling, mitochondrial biogenesis, and lipogenesis. PMID: 26968895
  30. elevating nuclear O-GlcNAc increases intracellular insulin levels and preserves glucose-stimulated insulin secretion during chronic hyperglycemia PMID: 26598517
  31. Data (including data from studies in knockout/transgenic mice) suggest INS is required for lipogenic effects of activation of LXRalpha in liver; INS is not required to down-regulate gene expression in ER stress or inflammation (as seen in diabetes). PMID: 26511317
  32. the insulin-InsR signaling drives multipotent progenitors differentiation into lymphoid lineages in early lymphopoiesis. PMID: 26573296
  33. The target miRNAs are closely associated with dysregulation of insulin/PI3K-AKT signaling, suggesting that the Cmah-null mice could be a useful model for studying diabetes. PMID: 25243123
  34. the inhibitory effect of CRFR2 signaling on insulin action is mediated by cAMP in a mammalian target of rapamycin-dependent manner. PMID: 25875045
  35. This study discloses age-dependent changes in insulin CSF/serum ratios in humans. In the elderly, cerebral insulin resistance might be partially attributed to an impaired transport of insulin into the central nervous system PMID: 25965336
  36. adiponectin. Taken together, our results show that adiponectin is stored in a unique vesicular compartment, and released through a regulated exocytosis pathway that is dependent on insulin signalling. PMID: 26330614
  37. LKB1 is essential for mitochondrial maintenance and negatively regulates a distal step of insulin secretion. PMID: 26139601
  38. ubiquitin-like protein 4A (Ubl4A) plays a crucial role in insulin-induced Akt plasma membrane translocation. PMID: 26195787
  39. synaptotagmin-7 is directly activated by GLP-1 signaling and may serve as a drug target for boosting insulin secretion. PMID: 26216970
  40. The paracrine actions of Ucn3 activate a negative feedback loop that promotes somatostatin release to ensure the timely reduction of insulin secretion upon normalization of plasma glucose. PMID: 26076035
  41. Tcf7l2 is regulating proinsulin expression directly via Isl1, Ins1 and indirectly via MafA, NeuroD1 and Pdx1. PMID: 25015099
  42. elevated adiponectin levels improve systemic lipid metabolism in the near absence of insulin. PMID: 25339419
  43. the RhoA/ROCK signaling pathway is involved in insulin release through the up-regulation of Cx36 expression in 3D-cultured MIN6 cells. PMID: 25129107
  44. Analyzed was insulin translation in islets and in INS-1 cells. Insulin translational levels were significantly increased in islets of mice fed a high-fat diet to meet systemic demand, without altering its transcriptional levels. PMID: 25686499
  45. Data indicate that Src homology-2 domain containing protein B (SHB) deficiency causes a chronic increase in beta-cell focal adhesion kinase (FAK) activity that perturbs the normal insulin secretory characteristics of beta-cells. PMID: 25274988
  46. The activation of Cav-1 during the adipocyte differentiation process could facilitate the maintenance of insulin sensitivity by mature adipocytes isolated from additional external stimuli. PMID: 24751908
  47. GX sPLA2 negatively regulated pancreatic insulin secretion by augmenting COX-2-dependent PGE2 production. PMID: 25122761
  48. Diet-induced obesity mice exhibited significant increases in body weight, plasma glucose, insulin, and IGF1. PMID: 24914941
  49. The over-expression of miR-200a in the hypothalamus of obese mice is linked to leptin and insulin signaling impairment. PMID: 24394757
  50. Mouse Ins2 and Ins1 promoters were transiently activated in mouse fetal hepatocytes of embryonic days 13.5 and 16.5, respectively. PMID: 24258027

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Insulin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*