Recombinant Mouse Insulin-1(Ins1)

In Stock
Code CSB-EP355623MO
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P01325
Lead Time 3-7 business days
Relevance Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Ins-1
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Research Area others
Source E.coli
Gene Names Ins1
Protein Names Recommended name: Insulin-1Cleaved into the following 2 chains: 1. Insulin-1 B chain 2. Insulin-1 A chain
Expression Region 25-108aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 14.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Subcellular Location Secreted
Protein Families Insulin family
Database Links

KEGG: mmu:16333

STRING: 10090.ENSMUSP00000049095

UniGene: Mm.46269

Related Products

Ins1 Antibodies

Ins1 Antibodies for Mus musculus (Mouse)

Ins1 Proteins

Ins1 Proteins for Mus musculus (Mouse)

Ins1 ELISA Kit

Ins1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.