Recombinant Mouse Allograft inflammatory factor 1 (Aif1)

In Stock
Code CSB-EP001490MO
Abbreviation Recombinant Mouse Aif1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP001490MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Aif1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP001490MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Aif1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Aif1
Uniprot No.
Research Area
Others
Alternative Names
Aif1; Iba1Allograft inflammatory factor 1; AIF-1; Ionized calcium-binding adapter molecule 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
2-147aa
Target Protein Sequence
SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
Gene References into Functions
  1. Aif1 is important for bacterial and particle transcytosis in M cells. PMID: 28224999
  2. These findings indicate that the expression of AIF-1 in macrophages is critical for the activation of renal fibroblasts to a profibrotic phenotype. PMID: 29749461
  3. Macrophage-derived AIF-1 up-regulated reactive oxygen species production, adipokine TNFalpha, IL6, resistin release, and inhibited adiponectin secretion. PMID: 29788012
  4. A new subset of resident macrophages in the intestinal muscularis externa was discovered, identified as iba1(pos) CD169(neg). PMID: 27860408
  5. These results suggest that AIF-1 plays an important role in the mechanism underlying lung fibrosis, and may provide an attractive new therapeutic target. PMID: 29225172
  6. AIF-1 plays an important role in the mechanism underlying acute lung injury. PMID: 26911661
  7. These results imply daintain/AIF-1 triggers type 1 diabetes probably via arousing immune cells activation and induction of NO production in pancreas of NOD mice. PMID: 23022189
  8. AIF-1 was overexpressed in the liver of BALB/c mice infected with S. japonicum, and the interaction between AIF-1 and TNF-alpha or other cytokines played an important role in the pathogenesis and progression of hepatic schistosomiasis. PMID: 22150368
  9. Data suggest a strong association between AIF-1 expression, NF-kappaB activation, and development of experimental atherosclerosis. PMID: 21862018
  10. AIF-1 can induce IL-6 secretion on mononuclear cells and fibroblast chemotaxis. AIF-1 may accordingly provide an attractive new target for antifibrotic therapy in SSc as well as Scl GVHD. PMID: 21040744
  11. interferon gamma inducable and macrophage restricted expression requires Pu.1 PMID: 11861656
  12. This study demonstrated for the first time that allograft inflammatory factor-1(AIF-1) was expressed in uterus, and a correlation between AIF-1 production and fetal resorption in mice. PMID: 14506935
  13. These data indicate that AIF-1 mediates atherogenesis-initiated signaling and activation of macrophages. PMID: 16291819
  14. The molecular conformational change induced by Ca(2+)-binding of Iba1 is different from that found in the classical EF-hand proteins, which demonstrates that Iba1 has an unique molecular switching mechanism dependent on Ca(2+)-binding. PMID: 17011575
  15. AIF-1/Iba1 can be regarded a "pan-macrophage marker" because, except for alveolar macrophages, all subpopulations of macrophages examined express AIF-1/Iba1. PMID: 17874251
  16. allograft inflammatory factor 1 (AIF-1) expression results in increased signal transduction, neointimal formation, and vascular smooth muscle cell proliferation in injured mouse carotid arteries. PMID: 17991871
  17. These results suggest that enhanced AIF-1 expression leads to augmented incorporation of degenerated LDL by macrophages and promotes development of atherosclerotic vasculopathy. PMID: 18204784
  18. Iba1 was heavily expressed in the VM-M2, VM-M3 and RAW cells, but was mostly undetectable in the VM-NM1 cells and the AC cells. These findings support the microglial/macrophage origin of the metastatic VM-M2, VM-M3 tumor cells. PMID: 18398829
  19. AIF-1 is expressed in endothelial cells, macrophages and T cells in systemic sclerosis (SSc). PMID: 16868985

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, phagocytic cup.
Tissue Specificity
Abundantly expressed in the testis, moderately in the spleen and lymph nodes and at low levels in the liver and thymus. Detected in macrophages.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*