Recombinant Mouse Alpha-actinin-4 (Actn4), partial

In Stock
Code CSB-EP001244MO
Abbreviation Recombinant Mouse Actn4 protein, partial
MSDS
Size $256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-267aa
Target Protein Sequence
MVDYHAANQAYQYGPNSGGGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. Probably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation. Involved in tight junction assembly in epithelial cells probably through interaction with MICALL2. Links MICALL2 to the actin cytoskeleton and recruits it to the tight junctions. May also function as a transcriptional coactivator, stimulating transcription mediated by the nuclear hormone receptors PPARG and RARA.
Gene References into Functions
  1. Focal segmental glomerulosclerosis Actn4 mutation promotes podocyte detachment through maladaptation to periodic stretch. PMID: 29378953
  2. ACTN4 is a transcriptional coactivator of NF-kappaB. PMID: 25411248
  3. sLZIP negatively regulates skeletal muscle differentiation via interaction with ACTN4. PMID: 24375477
  4. the C-terminal tail of alpha-actinin-4 is essential for its function in cell migration and adhesion to substratum. PMID: 23466492
  5. Dexamethasone mey protect actin cytoskeleton stabilization from adriamycin-induced podocyte injury via alpha-actinin-4. PMID: 22804863
  6. anti-dsDNA Fab may enhance F-actin formation by the proprietary modification of alpha-actinin-4 PMID: 22929799
  7. Together, these results indicate that alpha-actinin and the actin cytoskeleton are important components of the cisternal organelle that are probably required to stabilize the AIS. PMID: 21940706
  8. Results suggest that ACTN4 is essential for maintaining normal spreading, motility, cellular and nuclear cross-sectional area, and contractility of lung fibroblasts by maintaining the balance between transcellular contractility and cell-adhesion. PMID: 21085685
  9. newly developed mouse model of ACTN4-associated FSGS suggests a cause-and-effect relationship between actin cytoskeleton dysregulation by mutant alpha-actinin-4 and the deterioration of the nephrin-supported slit diaphragm complex. PMID: 12707390
  10. nonsarcomeric alpha-actinin-4 is involved in the regulation of cell movement PMID: 12782671
  11. ACTN4 has a role promoting tumorigenicity and regulating cell motility PMID: 15048094
  12. FSGS-associated Actn4 impairs cytoskeletal dynamcs in podocytes. PMID: 16837921
  13. alpha-actinin-4 interacts with integrins and strengthens the podocyte-GBM interaction thereby stabilizing glomerular architecture and preventing disease PMID: 17082197
  14. The different genetic defects in Actn4 produce a spectrum of glomerular morphologic lesions depending on the specific combination of normal and/or defective alleles. PMID: 18185509
  15. Although actinin-4 bound to JRAB/MICAL-L2 without Rab13, the actinin-4-JRAB/MICAL-L2 interaction was enhanced by Rab13 activation. PMID: 18332111
  16. Alpha-actinin-4 K256E triggers several metabolic abnormalities, which may lead to glomerular epithelial cell injury and glomerulosclerosis. PMID: 19640905

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Cell junction. Cytoplasm, cytoskeleton, stress fiber. Cytoplasm, perinuclear region.
Protein Families
Alpha-actinin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*