Recombinant Mouse Aquaporin-7(Aqp7), partial

Code CSB-MP001967MO1f5
Abbreviation Recombinant Mouse Aqp7 protein, partial
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
AQP-7;Aquaglyceroporin-7
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
221-303aa
Target Protein Sequence
FTFIAGWGKQVFRAGNNWWWVPVVAPLLGAYLGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.0 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-GFP-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Forms a channel that mediates water and glycerol transport across cell membranes at neutral pH. The channel is also permeable to urea. Plays an important role in body energy homeostasis under conditions that promote lipid catabolism, giving rise to glycerol and free fatty acids. Mediates glycerol export from adipocytes. After release into the blood stream, glycerol is used for gluconeogenesis in the liver to maintain normal blood glucose levels and prevent fasting hypoglycemia. Required for normal glycerol reabsorption in the kidney.
Gene References into Functions
  1. AQP-7 and -9 showed differential staining pattern in different stages of mouse estrus cycle. AQP-7 and -9-mediated glycerol transport in tanycyte cells might be under hormonal control to use glycerol as a potential energy substrate during mouse estrus cycle. PMID: 27746040
  2. upregulation of AQP7 plays an important role in improving of tolerance to hyperosmotic stress and survival of oocytes during cryopreservation by vitrification. PMID: 26634435
  3. AQP7 is expressed in human and mouse oocytes and upregulated by cryoprotectants. PMID: 23290745
  4. The over-expression of AQP7 contributes to improve insulin resistance in adipocytes, which is potentially correlated with the increased phosphorylation of PKB. PMID: 22877989
  5. Xenopus oocytes microinjected with either AQP7 or AQP9 cRNA (cloned from mouse adipocyte and rat liver, respectively) exhibited a 10-fold increase in arsenite permeability, indicating that both aquaglyceroporins recognize and transport arsenite. PMID: 11972053
  6. AQP7 may, directly or indirectly, play a role at a distal site in the exocytotic pathway. PMID: 22415076
  7. AQP7 in skin dendritic cells is primarily involved in antigen uptake and in the subsequent migration of them and is responsible for antigen presentation and the promotion of downstream immune responses. PMID: 21968069
  8. CM-chitin exerts anti-adipogenic effect on lipid accumulation through modulations of AMPK and aquaporin-7 signal pathways. PMID: 20573496
  9. Aquaporin 7 expansion during uterine decidualization is associated with elevated uterine glycerol accumulation and glycerol kinase expression. PMID: 21130427
  10. Coordinated regulation of fat-specific and liver-specific glycerol channels, aquaporin adipose and aquaporin 9. PMID: 12351427
  11. Epinephrine-stimulated glycerol secretion was also impaired in Aqp7 knockdown adipocytes PMID: 15591341
  12. adipocyte hypertrophy in AQP7 deficiency results from defective glycerol exit PMID: 15746100
  13. study clearly identified some physiological roles of AQP7 in the kidney; although AQP7 plays a minor role in water transport, AQP7 constitutes a major glycerol-reabsorbing pathway in the kidney PMID: 15998844
  14. AQP7 disruption elevates adipose glycerol kinase activity, accelerates triglycerides synthesis in adipocytes, and, finally, develops obesity. PMID: 16009937
  15. AQP7 is an important structural element in the choroid plexus and is possibly involved in the production of cerebrospinal fluid during brain development in mice PMID: 17052846
  16. AQP7 is expressed in capillary endothelia of adipose tissue (and cardiac and striated muscle) and is upregulated in white adipose tissue in response to streptozotocin-induced diabetes mellitus supporting its role in glycerol metabolism. PMID: 17077387
  17. analysis of the role of AQP7 in the testis and sperm using AQP7 knockout mice; male AQP7 knockout mice were not sterile, and their sperm did not show any morphologic or functional abnormalities PMID: 17123523
  18. Lowered gene expression of adipose triglyceride lipase and aquaglyceroporin 7 in peroxisome proliferator-activated receptor alpha null mice is not limiting for adipose triglyceride breakdown in vivo during fasting PMID: 17245390
  19. Data show that pancreatic beta cells express aquaporin 7, which appears to be a key regulator of intraislet glycerol content as well as insulin production and secretion. PMID: 17576812
  20. Both water influx and efflux occurred faster in Aqp7(-/-) sperm than wild-type. PMID: 18829704
  21. Follicles that were healthy but did not form an antrum or produce appropriate levels of steroids, however, demonstrated increasing levels of Star, Aqp7, Aqp8, and Hif1a and a 15-fold increase in Cyp19a1 at Day 8 of culture. PMID: 19005169
  22. AQP7 acts as a glycerol facilitator in cardiomyocytes and that glycerol is a substrate for cardiac energy production. PMID: 19297367

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm, cell cortex. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Lipid droplet.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Detected in proximal tubules in kidney. Detected in the capillary network between muscle fibers in skeletal muscle and heart, and in spermatids and on spermatozoa tails in testis and epididymis. Detected in white and brown adipose tissue, especially on sm
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*