Name: Recombinant Mouse Arginase-1 (Arg1)
Brand: CUSABIO
SKU: CSB-YP733775MO

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Arg1

Uniprot No.

Q61176

Research Area

Others

Alternative Names

Arg1Arginase-1; EC 3.5.3.1; Liver-type arginase; Type I arginase

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

1-323aa

Target Protein Sequence

MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

36.8kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To prepare this Recombinant Mouse Arg1 protein, the recombinant DNA was required, which was generated by fusing the Arg1 gene with N-terminal 6xHis tag sequence. Once the recombinant DNA was amplified and purified, a protein expression system, Yeast, was needed for this Arg1 protein production. After purification, a premium Arg1 recombinant proteinwas obtained. According to SDS-PAGE, its purity turns out to be 90%+.

Arg1 is a gene encoding a protein named arginase-1 (also commonly known as liver-type arginase or type I arginase). The protein encoded by this gene is a liver-specific hydrolase that catalyzes the conversion of l-arginine to l-ornithine and urea in the final step of the urea cycle. Urea cycle refers to the breakdown and removal of nitrogen from the body. Arginase is one of six enzymes in this process. Accumulating studies has reported that Arg-1 has been shown by immunohistochemistry to be concentrated in periportal hepatocytes.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Do you know the concentration and amount of time for the rArg1 mouse protein, or have any citations using this product?

Thanks for your email.
1. Protein Concentration
The concentration of the latest lot (Lot 03199) of CSB-YP733775MO is 0.9mg/ml.
The concentration of the latest lot (Lot 03852) of CSB-EP733775MO is 1mg/ml.
If you have requirement for protein concentration, you can inform in advance.
There are multiple batches of CSB-YP733775MO, and there are enough lyophilized powder in stock, which can basically meet your needs of concentration.
2. Reference Literature
This protein expressed from E.coli and Yeast expression systems have been ordered many times by other customers, but we have not received any feedback yet, so we are unable to provide any reference literature for this product.
The protein that we provide is full-length and it's purified under mild conditions, which basically can meet your general applications.

I am interested in buying active enzyme: recombinant arginase 1 of mouse origin. Therefore I wonder whether your product is just a protein or it also has an enzymatic activity? If yes, could you provide me its activity level?

Thanks for your inquiry.
This protein was ordered for several times. We provide the full length protein, and Yeast expression system also has post-translational modification, so it is active in theory. We will share the activity information with you when we finish activiry test.

Target Background

Function

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.; Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion. In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival. Plays a role in the immune response of alternatively activated or M2 macrophages in processes such as wound healing and tissue regeneration, immune defense against multicellular pathogens and parasites, and immune suppression and allergic inflammation; the regulatory outcome seems to be organ specific. In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs) plays a role in suppression of T cell-mediated antitumor immunity.

Gene References into Functions

Our studies provide proof-of-concept for gene-editing at the Arg1 locus and highlight the challenges that lie ahead to restore sufficient liver-based urea cycle function in patients with urea cycle disorders. PMID: 28566761
This study shows for the first time that diabetes-induced increases in arginase 1 expression promotes endothelial cell senescence through the activation of p16INK4A and p53 signaling pathways. PMID: 29673160
findings identified a novel function of the VEGFR1 signaling in avoiding over-expression of Arginase 1 potentially to maintain the proper innate immune response. PMID: 29110610
Up-regulation of arginase 1 expression/activity in vascular endothelial cells has an integral role in diet-induced cardiovascular dysfunction and metabolic syndrome. PMID: 29048462
Complete ablation of Arg1 in the lung affects mRNA abundance of arginine-transporting and -metabolizing genes, and pro-inflammatory genes, but not methacholine responsiveness or accumulation of inflammatory cells. PMID: 29183288
Data suggest that Arg1 mRNA and protein expression in liver are significantly higher in obese mice (fed high-fat diet) than in control mice; hepatic Arg1 levels positively correlate with plasma Arg1 levels and negatively correlate with L-arginine bioavailability in plasma. Increased expression of hepatic Arg1 and reduced plasma L-arginine and NO(2)(-) may lead to vascular endothelial dysfunction even in early obesity. PMID: 29098611
Data suggest that chronic hypoxia enhances HIF-2alpha stability, which causes increased arginase expression and dysregulates normal vascular NO homeostasis. PMID: 27432976
high-fat/high-sucrose diet-induced visceral adipose tissue inflammation is mediated by endothelial cells-A1 expression/activity. PMID: 28835451
Deletion of Arg1 in hematopoietic cells adversely affects blood leukocyte counts and increases foam cell formation. However, no effects on atherosclerosis could be demonstrated, indicating that hematopoietic Arg1 function is not a decisive factor in atherosclerotic plaque formation. PMID: 27998825
diabetes-dependent increase in renal arginase-2 expression also requires arginase-1 expression in macrophages PMID: 28446459
this study shows that mice lacking Arg1 in macrophages develop increased allergic contact hypersensitivity PMID: 28747341
this study shows that Ron is expressed in a subpopulation of macrophages during chronic inflammation induced by obesity that exhibit a repair phenotype as determined by the expression of arginase 1 PMID: 27233965
Arginase 1 was highly expressed by tumor-associated Gr1+ microglia and macrophages. PMID: 27936099
This study uncovers synergistic activation of Arg1 by retinoic acid and IL-4 in M2 macrophages. PMID: 27166374
this study shows that group 2 innate lymphoid cells selectively express arginase 1 and that this is critical for their bioenergetics, proliferation and function PMID: 27043409
this study shows that c-Jun regulates the activation state of macrophages and promotes arthritis via differentially regulating cyclooxygenase-2 and arginase-1 levels PMID: 28298526
deletion or TNF-mediated restriction of Arg1 unleashes the production of nitric oxide by NOS2, which is critical for pathogen control. PMID: 27117406
Data indicate that transfected mouse arginase-1 (Arg-I) promotes endothelial senescence and inflammatory responses through eNOS-uncoupling in human umbilical vein endothelial cells (HUVEC cells). PMID: 28153047
Arg1 is down-regulated during osteoclast differentiation and may negatively regulate osteoclast differentiation by regulating nitric oxide production. PMID: 26475291
Results show that arginase 1 is abundantly present in the bone and bone marrow stromal cells and reveal the role of its deregulation in diabetes-induced bone complications. * HFHS diet induced Arginase activity and expression in bone and bone marrow. PMID: 26704078
T Lymphocyte Inhibition by Tumor-Infiltrating Dendritic Cells Involves Ectonucleotidase CD39 but Not Arginase-1. PMID: 26491691
The production of arginase-1 by tumor cells leads to an ineffective anti-tumor immune response. PMID: 24614600
Arg1+ microglia are involved in Abeta plaque reduction during sustained, IL-1beta-dependent neuroinflammation PMID: 26538310
findings suggest that increased IL-17A expression by macrophages in E7-expressing skin exposed to DNCB promotes arginase-1 induction and contributes directly to the observed hyperinflammation. PMID: 25720383
Arginase 1 is crucially involved in Ang II-induced smooth muscle cell proliferation and arterial fibrosis and stiffness and represents a promising therapeutic target. PMID: 25807386
FoxO4 activates Arg1 transcription in endothelial cells in response to MI, leading to downregulation of nitric oxide and upregulation of neutrophil infiltration to the infarct area. PMID: 26438688
TAT fused to WW2/WW3 of Smurf2 could interfere with TGF-beta signaling and reduce ArgI gene expression. PMID: 25612247
ARG1 activity may participate in the pathogenesis of lymphoproliferative and myeloproliferative disorders. PMID: 26363032
data indicate that helminth coinfection induces arginase-1-expressing type 2 granulomas, thereby increasing inflammation and TB disease severity. PMID: 26571397
Flow cytometric analysis of intrasplenic leukocytes exposed the presence of a transient population of activated neutrophils that correlated quantitatively with elevated ArgI levels in culture media PMID: 25966956
Arginase 1 activity worsens lung-protective immunity against Streptococcus pneumoniae infection. PMID: 25789453
Arg1 expression is decreased, and Arg2 expression is increased in the newborn congenital obstructive nephropathy and in the mouse model. PMID: 25205225
Promoter region methylation was decreased at Arg1 in THC-induced myeloid-derived suppressor cells, which then expressed higher Arg1 levels. PMID: 25713087
Arg1 plays a central role in the control of TB when NOS2 is rendered ineffective by hypoxia. PMID: 25201986
arginase I activity is required for M2 macrophages mediated protection during DSS-induced colitis in PI3Kp110delta-deficient mice. PMID: 25124254
the cross talk between HDAC4 and STAT6 is an important regulatory mechanism of Arg1 transcription in dendritic cells PMID: 25332236
Diabetic mice exhibit elevated vascular Arg1 and impaired vascular endothelial and nitrergic function. PMID: 23977269
A myeloid cell uptake of damaged retinal pigment epithelium or its derivatives as a mechanism generating VEGF (+) Arg-1(+) phenotype in vivo, is demonstrated. PMID: 23977372
Our results demonstrate that HPV16.E7 protein enhances drug associated production of arginase-1 by myeloid cells and consequent inflammatory cellular infiltration of skin. PMID: 24732401
Reduced arginase-1 activity in Arg1(fl/fl)/Tie2-Cre(tg/-) mice resulted in increased inflammatory response and nitric oxide production by NOS2. PMID: 24465919
these data support the notion that PTEN contributes to cell fate decisions of macrophages exemplified by increased Arginase I expression. PMID: 25015834
tumor myeloid cells inhibit the adaptive immune response after radiation therapy through expression of the enzyme arginase I PMID: 24992164
neither induction of alternative activation nor expression of arginase1 are critical features of disease mediated by attenuated or virulent Francisella species. PMID: 24324751
A kinesin heavy chain released by T. brucei induces IL-10 and arginase-1 through SIGN-R1 signaling in myeloid cells, which promotes early trypanosome growth and favors parasite settlement in the host. PMID: 24204274
ATRA enhances both Arg-1 and iNOS expression in IFN-gamma-treated DCs, resulting in a tolerogenic phenotype. PMID: 24790153
Murine primary macrophages treated with HDL showed increased gene expression for the M2 markers Arginase-1 (Arg-1) and Fizz-1 PMID: 23991225
ILC2s are a novel source of Arg1 in resting tissue and during allergic inflammation. PMID: 23924659
In preclinical murine models reduced Arg expression directly correlates with delayed healing of skin wounds. PMID: 23552798
Our objective was to elucidate mechanisms involved in modulating arginase I induction by IL-4 in murine M2 macrophages PMID: 23913966
wall shear stress is a key biomechanical regulator of arginase during atherosclerotic plaque formation and stability PMID: 23390893

Hide All

Subcellular Location

Cytoplasm. Cytoplasmic granule.

Protein Families

Arginase family

Tissue Specificity

Expressed in macrophages. Expressed in precursor and mature group 2 innate lymphoid cells (ILC2s). Expressed in lung tumor-associated myeloid cells. Expressed in lung tumor-infiltrating dendritic cells.

Database Links

KEGG: mmu:11846

STRING: 10090.ENSMUSP00000020161

UniGene: Mm.154144

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address