Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1),partial


In Stock
Code CSB-YP015007MO1
Product Type Recombinant Protein
Size US$2474
Uniprot No. P19437
Lead Time 3-7 business days
Relevance This protein may be involved in the regulation of B-cell activation and proliferation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Research Area Others
Source Yeast
Gene Names Ms4a1
Expression Region 111-291aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 22.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein may be involved in the regulation of B-cell activation and proliferation.
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor
Protein Families MS4A family
Database Links

KEGG: mmu:12482

STRING: 10090.ENSMUSP00000126422

UniGene: Mm.4046

Pathway Hematopoietic cell lineage

Q&A and Customer Reviews

Q&A
Q:

I am asking about the purpose of the SUMO tag. Is it just for solubilzation? Can you please send the sequence with the tag?

A:
Thanks for your inquiry. CSB-YP015007MO1 is N-terminal 6xHis-tagged, not N-terminal 6xHis-SUMO-tagged. Kindly confirm.The complete sequence is as follows.

EAEAYVHHHHHHEFRT + VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP


Customer Reviews

Related Products

Ms4a1 Antibodies

Ms4a1 Antibodies for Mouse

Ms4a1 Proteins

Ms4a1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.