Code | CSB-YP015007MO1 |
Abbreviation | Recombinant Mouse Ms4a1 protein, partial |
MSDS | |
Size | $368 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Dive deeper into the intricate world of immunology with our Recombinant Mouse Ms4a1, also known as CD20. A crucial tool for researchers, this B-lymphocyte antigen CD20, also referenced as Ly-44 or Ms4a2, is recombinantly produced in yeast and provides a valuable resource for elucidating the complexities of immune responses.
Exhibiting a partial protein length (111-291aa), this product is expressed with a N-terminal 6xHis-tag, ensuring efficient purification and robust stability. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Mouse Ms4a1 guarantees rigorous quality for your experimental needs. Choose between the convenience of a liquid form or the stability of lyophilized powder to best fit your research workflow.
There are currently no reviews for this product.
I am asking about the purpose of the SUMO tag. Is it just for solubilzation? Can you please send the sequence with the tag?
EAEAYVHHHHHHEFRT + VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP