Home
Protein
Recombinant Proteins
Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

^{In Stock}

Code	CSB-YP015007MO1
MSDS	MSDS
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Ms4a1

Uniprot No.

P19437

Research Area

Others

Alternative Names

Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

111-291aa

Target Protein Sequence

VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

22.3kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Dive deeper into the intricate world of immunology with our Recombinant Mouse Ms4a1, also known as CD20. A crucial tool for researchers, this B-lymphocyte antigen CD20, also referenced as Ly-44 or Ms4a2, is recombinantly produced in yeast and provides a valuable resource for elucidating the complexities of immune responses.

Exhibiting a partial protein length (111-291aa), this product is expressed with a N-terminal 6xHis-tag, ensuring efficient purification and robust stability. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Mouse Ms4a1 guarantees rigorous quality for your experimental needs. Choose between the convenience of a liquid form or the stability of lyophilized powder to best fit your research workflow.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am asking about the purpose of the SUMO tag. Is it just for solubilzation? Can you please send the sequence with the tag?

Thanks for your inquiry. CSB-YP015007MO1 is N-terminal 6xHis-tagged, not N-terminal 6xHis-SUMO-tagged. Kindly confirm.The complete sequence is as follows.

EAEAYVHHHHHHEFRT + VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Target Background

Function

B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.

Gene References into Functions

Our findings indicate that anti-CD20-IFNalpha eradicates B-cell lymphoma by employing tumor cells as antigen-presenting cells to reactivate tumor-infiltrating CD8(+) T cells and synergizing with anti-PD-L1 treatment PMID: 28533311
Galectin-1 has a role in driving lymphoma CD20 immunotherapy resistance in a mouse model PMID: 26888257
Results indicate that an antigen-specific B cell response towards intracellular pathogens can be generated during anti-CD20 depletion therapy. PMID: 26261496
this study demonstrates a role for CD20 in B cell activation and T-dependent humoral immunity. PMID: 23966626
CD20 is required for store-operated calcium entry in C2C12 myoblasts. PMID: 22982241
immunization of mice with the CD20 extracellular domain-6 using Freund's or QS-21 adjuvants was shown to exert significant biological effects in vivo with the pronounced depletion of splenic B cells. PMID: 20189250
type I CD20 antibody cytotoxicity critically depends on Fc receptor ITAM signaling PMID: 20354182
CD20 deficiency in humans results in impaired T cell-independent antibody responses. PMID: 20038800
review of structure, function, tissue and cell distribution PMID: 12144126
Anti-CD20 antibodies rapidly depleted the vast majority of circulating and tissue B cells in an isotype-restricted manner dependent on effector cell Fc receptor expression. PMID: 15210744
expression in bacterial cells; isolation and biophysical and structural studies PMID: 16285718
In mice treated with anti-CD20 mAb, development of arthritis was significantly reduced in comparison to control mAb-treated mice PMID: 18354225
involvement of CD20 in calcium influx PMID: 18474602