Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP015007MO1 |
| Product Type | Recombinant Protein |
| Size | US$2474 |
| Uniprot No. | P19437 |
| Lead Time | 3-7 business days |
| Relevance | This protein may be involved in the regulation of B-cell activation and proliferation. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20 |
| Species | Mus musculus (Mouse) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP |
| Research Area | Others |
| Source | Yeast |
| Gene Names | Ms4a1 |
| Expression Region | 111-291aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 22.3kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | This protein may be involved in the regulation of B-cell activation and proliferation. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor |
| Protein Families | MS4A family |
| Database Links |
KEGG: mmu:12482 STRING: 10090.ENSMUSP00000126422 UniGene: Mm.4046 |
| Pathway | Hematopoietic cell lineage |
I am asking about the purpose of the SUMO tag. Is it just for solubilzation? Can you please send the sequence with the tag?
EAEAYVHHHHHHEFRT + VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Ms4a1 Antibodies for Mouse
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA015007LD01MO | Ms4a1 Antibody, Biotin conjugated | Mouse | ELISA |
| CSB-PA015007LC01MO | Ms4a1 Antibody, FITC conjugated | Mouse | ELISA |
| CSB-PA015007LB01MO | Ms4a1 Antibody, HRP conjugated | Mouse | ELISA |
| CSB-PA015007LA01MO | Ms4a1 Antibody | Mouse, Human | ELISA, WB |
Ms4a1 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP015007MO2 | Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1) ,partial | E.coli |
| CSB-YP015007MO2 | Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1),partial | Yeast |
| CSB-CF015007MO | Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1) | in vitro E.coli expression system |
| CSB-YP015007MO CSB-EP015007MO CSB-BP015007MO CSB-MP015007MO |
Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1),partial | Yeast E.coli Baculovirus Mammalian cell |
| CSB-EP015007MO1 CSB-BP015007MO1 CSB-MP015007MO1 |
Recombinant mouse B-lymphocyte antigen CD20(Ms4a1),partial | E.coli Baculovirus Mammalian cell |
| CSB-BP015007MO2 CSB-MP015007MO(F1) |
Recombinant mouse B-lymphocyte antigen CD20,partial | Baculovirus Mammalian cell |
Recombinant Macaca mulatta Growth hormone receptor(GHR),partial
Express system: E.coli
Species: Macaca mulatta (Rhesus macaque)
Recombinant Human Carbonyl reductase [NADPH] 1(CBR1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Inositol-trisphosphate 3-kinase B(ITPKB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Superoxide dismutase [Cu-Zn](Sod1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Glycogen phosphorylase, liver form(PYGL),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Dog Inactive pancreatic lipase-related protein 1(PNLIPRP1)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
