Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1)-VLPs

In Stock
Code CSB-MP015007MO
Abbreviation Recombinant Mouse Ms4a1 protein-VLPs
MSDS
Size $570
Order now
Image
  • CSB-MP015007MO is detected by Mouse anti-6*His monoclonal antibody.
  • The purity of VLPs was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
B-cell differentiation antigen Ly-44;Lymphocyte antigen 44;Membrane-spanning 4-domains subfamily A member 1;CD antigen CD20
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-291aa
Target Protein Sequence
MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.
Gene References into Functions
  1. Our findings indicate that anti-CD20-IFNalpha eradicates B-cell lymphoma by employing tumor cells as antigen-presenting cells to reactivate tumor-infiltrating CD8(+) T cells and synergizing with anti-PD-L1 treatment PMID: 28533311
  2. Galectin-1 has a role in driving lymphoma CD20 immunotherapy resistance in a mouse model PMID: 26888257
  3. Results indicate that an antigen-specific B cell response towards intracellular pathogens can be generated during anti-CD20 depletion therapy. PMID: 26261496
  4. this study demonstrates a role for CD20 in B cell activation and T-dependent humoral immunity. PMID: 23966626
  5. CD20 is required for store-operated calcium entry in C2C12 myoblasts. PMID: 22982241
  6. immunization of mice with the CD20 extracellular domain-6 using Freund's or QS-21 adjuvants was shown to exert significant biological effects in vivo with the pronounced depletion of splenic B cells. PMID: 20189250
  7. type I CD20 antibody cytotoxicity critically depends on Fc receptor ITAM signaling PMID: 20354182
  8. CD20 deficiency in humans results in impaired T cell-independent antibody responses. PMID: 20038800
  9. review of structure, function, tissue and cell distribution PMID: 12144126
  10. Anti-CD20 antibodies rapidly depleted the vast majority of circulating and tissue B cells in an isotype-restricted manner dependent on effector cell Fc receptor expression. PMID: 15210744
  11. expression in bacterial cells; isolation and biophysical and structural studies PMID: 16285718
  12. In mice treated with anti-CD20 mAb, development of arthritis was significantly reduced in comparison to control mAb-treated mice PMID: 18354225
  13. involvement of CD20 in calcium influx PMID: 18474602

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.
Protein Families
MS4A family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*