Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

In Stock
Code CSB-YP015007MO2
Abbreviation Recombinant Mouse Ms4a1 protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
132-291aa
Target Protein Sequence
ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) is produced through a yeast expression system, targeting amino acid residues 132-291. This partial protein comes with an N-terminal 6xHis-tag, which streamlines purification processes. SDS-PAGE analysis confirms purity levels exceeding 90%, suggesting this protein offers dependable quality for research applications. The product is designed exclusively for research purposes and should not be considered for therapeutic applications.

CD20 appears to be a cell surface molecule found mainly on B-lymphocytes. It seems to play an important role in B-cell development and differentiation. Research indicates CD20 may be involved in signal transduction pathways that control cell cycle progression and proliferation. Studies examining CD20 interactions and functions are likely crucial for advancing immunology and hematological research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Anti-CD20 Antibody Development and Characterization

This recombinant mouse CD20 protein fragment may serve as an antigen for creating antibodies against mouse CD20 in laboratory settings. The N-terminal His-tag appears to simplify purification and allows attachment to different surfaces during immunization protocols or screening assays. Scientists might find this protein useful for developing monoclonal or polyclonal antibodies specific to mouse CD20 for flow cytometry, immunohistochemistry, or Western blot work in murine B-cell studies. The high purity (>90%) suggests minimal contamination that could potentially disrupt antibody specificity.

2. Protein-Protein Interaction Studies

Scientists could use the His-tagged mouse CD20 fragment in pull-down assays to discover possible binding partners or interacting proteins in mouse B-cell lysates. The His-tag enables straightforward attachment to nickel-based affinity matrices, helping researchers capture proteins that specifically bind to the CD20 extracellular domain. This method might help clarify CD20's function in B-cell signaling pathways and reveal new regulatory mechanisms. The yeast expression system appears to provide appropriate eukaryotic protein folding that may be essential for preserving natural protein interactions.

3. ELISA-Based Binding Assays

Researchers can utilize the recombinant protein as a coating antigen in enzyme-linked immunosorbent assays to examine CD20-specific binding interactions. Scientists might investigate binding kinetics and specificity of current anti-CD20 antibodies or analyze sera from immunized animals. The His-tag enables oriented attachment to nickel-coated plates, which could enhance assay consistency and sensitivity. This application seems particularly useful for screening hybridoma supernatants during antibody development projects focused on mouse CD20.

4. Structural and Biochemical Characterization Studies

This purified CD20 fragment can undergo various biophysical analyses to better understand structural properties of the mouse CD20 extracellular domain. Methods like circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation might provide insights into protein folding, stability, and oligomerization states. The high purity level makes it appropriate for mass spectrometry analysis to verify protein identity and detect post-translational modifications. Such studies could contribute to understanding the molecular foundation of CD20 function in mouse B-cell biology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.
Gene References into Functions
  1. Our findings indicate that anti-CD20-IFNalpha eradicates B-cell lymphoma by employing tumor cells as antigen-presenting cells to reactivate tumor-infiltrating CD8(+) T cells and synergizing with anti-PD-L1 treatment PMID: 28533311
  2. Galectin-1 has a role in driving lymphoma CD20 immunotherapy resistance in a mouse model PMID: 26888257
  3. Results indicate that an antigen-specific B cell response towards intracellular pathogens can be generated during anti-CD20 depletion therapy. PMID: 26261496
  4. this study demonstrates a role for CD20 in B cell activation and T-dependent humoral immunity. PMID: 23966626
  5. CD20 is required for store-operated calcium entry in C2C12 myoblasts. PMID: 22982241
  6. immunization of mice with the CD20 extracellular domain-6 using Freund's or QS-21 adjuvants was shown to exert significant biological effects in vivo with the pronounced depletion of splenic B cells. PMID: 20189250
  7. type I CD20 antibody cytotoxicity critically depends on Fc receptor ITAM signaling PMID: 20354182
  8. CD20 deficiency in humans results in impaired T cell-independent antibody responses. PMID: 20038800
  9. review of structure, function, tissue and cell distribution PMID: 12144126
  10. Anti-CD20 antibodies rapidly depleted the vast majority of circulating and tissue B cells in an isotype-restricted manner dependent on effector cell Fc receptor expression. PMID: 15210744
  11. expression in bacterial cells; isolation and biophysical and structural studies PMID: 16285718
  12. In mice treated with anti-CD20 mAb, development of arthritis was significantly reduced in comparison to control mAb-treated mice PMID: 18354225
  13. involvement of CD20 in calcium influx PMID: 18474602

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.
Protein Families
MS4A family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*