Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

In Stock
Code CSB-YP015007MO2
Abbreviation Recombinant Mouse Ms4a1 protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
132-291aa
Target Protein Sequence
ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) is produced through a yeast expression system, targeting amino acid residues 132-291. This partial protein comes with an N-terminal 6xHis-tag, which streamlines purification processes. SDS-PAGE analysis confirms purity levels exceeding 90%, suggesting this protein offers dependable quality for research applications. The product is designed exclusively for research purposes and should not be considered for therapeutic applications.

CD20 appears to be a cell surface molecule found mainly on B-lymphocytes. It seems to play an important role in B-cell development and differentiation. Research indicates CD20 may be involved in signal transduction pathways that control cell cycle progression and proliferation. Studies examining CD20 interactions and functions are likely crucial for advancing immunology and hematological research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant mouse CD20 is produced in a yeast expression system as a partial fragment (132-291aa) with an N-terminal 6xHis-tag. CD20 is a transmembrane protein with four membrane-spanning domains, and its native function depends on proper folding, membrane integration, and potential post-translational modifications. The expression region (132-291aa) likely covers a portion of the extracellular loops and transmembrane domains but lacks the full N-terminal region (1-131aa), which may be critical for complete structural integrity. Yeast expression systems provide eukaryotic folding machinery that can support disulfide bond formation and glycosylation, but membrane proteins like CD20 often require lipid environments for correct folding and may not integrate properly in soluble expression. The N-terminal His-tag could potentially interfere with folding or function. No validation data (e.g., antibody binding assays, cellular activity tests) are provided. Therefore, while yeast expression increases the probability of correct folding compared to prokaryotic systems, the protein's folding status and bioactivity cannot be confirmed without experimental validation, and the partial nature raises concerns about functional integrity.

1. Anti-CD20 Antibody Development and Characterization

This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The high purity and defined fragment support consistent immunization and screening. However, if correctly folded, antibodies may recognize conformational epitopes relevant to native CD20; if misfolded, generated antibodies might not optimally bind the full-length, membrane-integrated CD20 in biological contexts, limiting utility for functional assays like flow cytometry.

2. Protein-Protein Interaction Studies

If the recombinant CD20 fragment is correctly folded and retains native structure, it could be used in pull-down assays to identify interaction partners, as the His-tag facilitates immobilization. However, if misfolded (likely due to the partial nature and lack of membrane context), interaction domains may be altered, leading to non-specific binding or failure to recognize genuine biological partners, compromising the validity of identified networks.

3. ELISA-Based Binding Assays

If properly folded, the His-tagged CD20 fragment can be used as a coating antigen in ELISA to study antibody binding or screen interactions, with the tag enabling oriented immobilization. However, if misfolded, the protein may not present native epitopes accurately, resulting in unreliable binding kinetics or false negatives in antibody screening assays.

4. Structural and Biochemical Characterization Studies

If correctly folded, the fragment is suitable for biophysical analyses like circular dichroism or dynamic light scattering to study domain properties. However, if misfolded, structural data would misrepresent the native CD20 architecture, and the partial nature limits insights into full-length protein behavior. The His-tag may also interfere with some structural measurements.

Final Recommendation & Action Plan

This yeast-expressed partial CD20 fragment requires validation before functional applications due to the challenges of expressing transmembrane proteins in soluble form and the lack of full-length context; the recommended action plan includes: first validating folding through biophysical methods (e.g., circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) and functional assays (e.g., binding tests with known anti-CD20 antibodies); if validation confirms proper folding, proceed with applications while noting the limitations of the partial fragment and potential tag interference; if misfolded, consider using full-length CD20 expressed in mammalian systems for membrane integration or obtain a commercially validated standard; for immediate use, antibody development can proceed but validate antibodies against native CD20 in B-cells, and avoid interaction or binding studies until folding is confirmed. Always include appropriate controls, such as full-length CD20 or cell-based assays, to ensure biological relevance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.
Gene References into Functions
  1. Our findings indicate that anti-CD20-IFNalpha eradicates B-cell lymphoma by employing tumor cells as antigen-presenting cells to reactivate tumor-infiltrating CD8(+) T cells and synergizing with anti-PD-L1 treatment PMID: 28533311
  2. Galectin-1 has a role in driving lymphoma CD20 immunotherapy resistance in a mouse model PMID: 26888257
  3. Results indicate that an antigen-specific B cell response towards intracellular pathogens can be generated during anti-CD20 depletion therapy. PMID: 26261496
  4. this study demonstrates a role for CD20 in B cell activation and T-dependent humoral immunity. PMID: 23966626
  5. CD20 is required for store-operated calcium entry in C2C12 myoblasts. PMID: 22982241
  6. immunization of mice with the CD20 extracellular domain-6 using Freund's or QS-21 adjuvants was shown to exert significant biological effects in vivo with the pronounced depletion of splenic B cells. PMID: 20189250
  7. type I CD20 antibody cytotoxicity critically depends on Fc receptor ITAM signaling PMID: 20354182
  8. CD20 deficiency in humans results in impaired T cell-independent antibody responses. PMID: 20038800
  9. review of structure, function, tissue and cell distribution PMID: 12144126
  10. Anti-CD20 antibodies rapidly depleted the vast majority of circulating and tissue B cells in an isotype-restricted manner dependent on effector cell Fc receptor expression. PMID: 15210744
  11. expression in bacterial cells; isolation and biophysical and structural studies PMID: 16285718
  12. In mice treated with anti-CD20 mAb, development of arthritis was significantly reduced in comparison to control mAb-treated mice PMID: 18354225
  13. involvement of CD20 in calcium influx PMID: 18474602

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.
Protein Families
MS4A family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*