Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Bmp15

Uniprot No.

Q9Z0L4

Research Area

Cardiovascular

Alternative Names

Growth/differentiation factor 9B

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

268-392aa

Target Protein Sequence

QACSIESDASCPSQEHDGSVNNQCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGICTRVLPYGLNSPNHAIIQSLVNELVNHSVPQPSCVPYNFLPMSILLIETNGSILYKEYEGMIAQSCTCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal hFc1-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.

Gene References into Functions

these data provide evidence that the preovulatory LH surge leads to upregulation of several forms of BMP15 protein secreted by the oocyte for putative sequestration and/or interaction with ovarian follicular somatic cells. PMID: 24548471
Data show that Rac1 induced nuclear import of STAT3 by physical binding, and nuclear STAT3 directly activated the transcription of essential oocyte-specific genes, including Jagged1, GDF9 and BMP15. PMID: 27050391
results support a model of activation for human GDF9 dependent on cumulin formation through heterodimerization with BMP15. Oocyte-secreted cumulin is likely to be a central regulator of fertility in mono-ovular mammals. PMID: 26254468
modified oocyte glycoproteins alter GDF9:BMP15 expression modifying follicle development resulting in the generation of more follicles PMID: 25416550
findings that GDF9:BMP15 heterodimers are the most bioactive ligands in mice and humans compared with homodimers explain many puzzling genetic and physiological data and have important implications for improving female fertility in mammals PMID: 23382188
show that purified mature regions of GDF9 and BMP15 synergistically interact in a specific manner which is not dependent on the presence of a pro-region. PMID: 21911477
Integral role of GDF-9 and BMP-15 in ovarian function. PMID: 21226076
oocyte-derived GDF9 and Bmp15 coordinate to promote the development of cumulus cells E2 and oocyte-derived paracrine factors GDF9 and bone morphogenetic protein 15 coordinate to promote the development of cumulus cells PMID: 21047911
The results showed that both GDF-9 and BMP-15 were detectable in oocytes from primary follicles onward, besides, BMP-15 also presented in granulosa cells (GCs) and follicular follicle of mature follicles in mouse PMID: 20857181
bone morphogenetic protein-15 could play a physiological role in the monotropic rise of FSH secretion by the pituitary during the estrous and menstrual cycle PMID: 12446622
GCNF-dependent repression of Bmp15 mediates gamete regulation of female fertility. PMID: 12912906
Bmp15 has a role in the development and function of the oocyte-cumulus cell complex in mice. PMID: 15531364
Based on the biological role of BMP-15, defects in the production of mouse BMP-15 mature protein could correlate with the high ovulation quota and litter size observed in mice PMID: 15809424
The functional mature form of BMP-15 is barely detectable in mouse oocytes until just before ovulation, when it is markedly increased. PMID: 16818886
BMP15 levels increase during gonadotropin-induced follicular development, in parallel with oocyte maturation PMID: 16943361
oocyte-derived BMP15 and FGFs cooperate to promote glycolysis in cumulus cells. PMID: 17553902
oocyte-derived paracrine factors, particularly, BMP15 and GDF9, promote cholesterol biosynthesis in cumulus cells, probably as compensation for oocyte deficiencies in cholesterol production PMID: 18045843
RT-PCR data shows an increase in oogenesis specific gene transcripts (Nobox, Oct4, Bmp15, Gdf9, Oogenesin1 and Oogenesin2) between the primordial until the preantral stages, with the exception of the Oogenesin1 transcripts under gonadotropin-induction. PMID: 19480014
The highest Bmp15 mRNA levels were detected in oocytes in the pre-antral follicle stage. PMID: 19553355

Hide All

Subcellular Location

Secreted.

Protein Families

TGF-beta family

Tissue Specificity

Ovary specific.

Database Links

KEGG: mmu:12155

STRING: 10090.ENSMUSP00000024049

UniGene: Mm.42160

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-MP002735MO
Abbreviation	Recombinant Mouse Bmp15 protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Bone morphogenetic protein 15 (Bmp15)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage