Product Details

Purity

≥95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Bmp5

Uniprot No.

P49003

Research Area

Neuroscience

Alternative Names

BMP-5;Bmp5

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

315-452aa

Target Protein Sequence

AASKRKNQNRNKSNSHQDPSRMPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

83.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 10xHis-HSA-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including cartilage and bone formation or neurogenesis. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical pathway such as MAPK p38 signaling cascade to promote chondrogenic differentiation.

Gene References into Functions

Data conclude that BMP-5 has stage-specific role to play during MC3T3E1 osteoblast differentiation in part by autocrine p38/Runx2/COLIA1 signaling. PMID: 28497879
Bmp5 gene thus contains an "injury response" control region that is distinct from embryonic enhancers, and that is activated by multiple types of injury in adult animals PMID: 25886903
Early endothelial outgrowth cells act protective in diabetic nephropathy, and such effects are significantly stimulated by BMP-5 PMID: 25080521
BMP-5 acts as a potent endothelial outgrowth cells agonist in murine AKI in the short and mid to long term PMID: 23678046
Bone morphogenetic protein 5 regulates the number of keratinocyte stem cells from the skin of mice. PMID: 21179110
Data indicate that locus coeruleus development requires either Bmp5 or Bmp7, and one is able to compensate for the loss of the other. PMID: 20493948
Variability in gene expression of BMP5 may be an important contributor to osteoarthritis genetic susceptibility PMID: 20021689
BMP5 is required not only for skeletal patterning during embryonic development, but also for bone response and remodeling to mechanical stimulation at specific anatomic sites in the skeleton PMID: 18380899
Bmp5 is expressed in many skeletal precursors and different enhancers control expression in individual bones. PMID: 19096511

Hide All

Subcellular Location

Secreted.

Protein Families

TGF-beta family

Database Links

KEGG: mmu:12160

STRING: 10090.ENSMUSP00000012281

UniGene: Mm.428950

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-MP002741MO
Abbreviation	Recombinant Mouse Bmp5 protein
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Bone morphogenetic protein 5 (Bmp5)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage