Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial

In Stock
Code CSB-EP803912MO
Abbreviation Recombinant Mouse Clec4g protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Clec4g
Uniprot No.
Research Area
Immunology
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
52-294aa
Target Protein Sequence
LLSSASSKLRVLLSHQDLLRTNASEQKMTLSSLKDDIGACRNCCSVTKAQLQTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASRDRENIRSELFQALEAVKRQNSSCEQCPPSWLPFQGSCYYFSETQATWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTRGRGYWLGLRAVRHLNKIQGYRWVDGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICEKRSSCY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Mouse Clec4g contains amino acids 52-294. The theoretical molecular weight of the Clec4g protein is 31.1 kDa. This Clec4g recombinant protein is manufactured in e.coli. The Clec4g gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant Clec4g protein during the following stages.

The mouse C-type lectin domain family 4 member G (Clec4g) is a transmembrane protein that belongs to the C-type lectin superfamily. It is predominantly expressed in immune cells, such as macrophages and dendritic cells. Clec4g plays a role in the recognition of pathogen-associated molecular patterns (PAMPs) and endogenous ligands. Through its carbohydrate recognition domain (CRD), Clec4g can interact with various glycan structures, contributing to innate immune responses. The activation of Clec4g is associated with the induction of pro-inflammatory cytokines and modulation of immune cell functions. Studying Clec4g aids in understanding innate immunity and the molecular mechanisms involved in pathogen recognition, providing potential targets for therapeutic interventions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds mannose, N-acetylglucosamine (GlcNAc) and fucose, but not galactose, in a Ca(2+)-dependent manner.
Gene References into Functions
  1. This study shows that C-type lectin LSECtin, a member of the DC-SIGN family, is a novel liver regulator for natural killer cells (NK cells). LSECtin could bind to NK cells in a carbohydrate-dependent manner and could regulate the number of hepatic NK cells. PMID: 27184407
  2. Data show that C-type lectin-like domain family 4, member g (Clec4g) suppresses beta-Site amyloid precursor protein cleaving enzyme-1 (BACE1)-mediated amyloid-beta (Abeta) peptides generation. PMID: 25957769
  3. When expressed in B16 melanoma cells, LSECtin promoted tumor growth, whereas its blockade slowed tumor growth in either wild-type or LSECtin-deficient mice. PMID: 24769443
  4. LSECtin-mediated signaling up-regulates the threshold of CD4(+) T cell activation via tuning the expression of Cbl-b. PMID: 22884358
  5. LSECtin may facilitate the reduction of liver inflammation at the cost of delaying virus clearance, an effect that might be hijacked by the virus as an escape mechanism. PMID: 23487419
  6. The studies provide a basis for using mouse LSECtin, and knockout mice lacking this receptor, to model the biological properties of the human receptor. PMID: 21257728
  7. Liver sinusoidal endothelial cell lectin, LSECtin, negatively regulates hepatic T-cell immune response. PMID: 19632227

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*