Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Clec4g

Uniprot No.

Q8BNX1

Research Area

Immunology

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

52-294aa

Target Protein Sequence

LLSSASSKLRVLLSHQDLLRTNASEQKMTLSSLKDDIGACRNCCSVTKAQLQTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASRDRENIRSELFQALEAVKRQNSSCEQCPPSWLPFQGSCYYFSETQATWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTRGRGYWLGLRAVRHLNKIQGYRWVDGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICEKRSSCY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.1 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Mouse Clec4g contains amino acids 52-294. The theoretical molecular weight of the Clec4g protein is 31.1 kDa. This Clec4g recombinant protein is manufactured in e.coli. The Clec4g gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant Clec4g protein during the following stages.

The mouse C-type lectin domain family 4 member G (Clec4g) is a transmembrane protein that belongs to the C-type lectin superfamily. It is predominantly expressed in immune cells, such as macrophages and dendritic cells. Clec4g plays a role in the recognition of pathogen-associated molecular patterns (PAMPs) and endogenous ligands. Through its carbohydrate recognition domain (CRD), Clec4g can interact with various glycan structures, contributing to innate immune responses. The activation of Clec4g is associated with the induction of pro-inflammatory cytokines and modulation of immune cell functions. Studying Clec4g aids in understanding innate immunity and the molecular mechanisms involved in pathogen recognition, providing potential targets for therapeutic interventions.

Target Background

Function

Binds mannose, N-acetylglucosamine (GlcNAc) and fucose, but not galactose, in a Ca(2+)-dependent manner.

Gene References into Functions

This study shows that C-type lectin LSECtin, a member of the DC-SIGN family, is a novel liver regulator for natural killer cells (NK cells). LSECtin could bind to NK cells in a carbohydrate-dependent manner and could regulate the number of hepatic NK cells. PMID: 27184407
Data show that C-type lectin-like domain family 4, member g (Clec4g) suppresses beta-Site amyloid precursor protein cleaving enzyme-1 (BACE1)-mediated amyloid-beta (Abeta) peptides generation. PMID: 25957769
When expressed in B16 melanoma cells, LSECtin promoted tumor growth, whereas its blockade slowed tumor growth in either wild-type or LSECtin-deficient mice. PMID: 24769443
LSECtin-mediated signaling up-regulates the threshold of CD4(+) T cell activation via tuning the expression of Cbl-b. PMID: 22884358
LSECtin may facilitate the reduction of liver inflammation at the cost of delaying virus clearance, an effect that might be hijacked by the virus as an escape mechanism. PMID: 23487419
The studies provide a basis for using mouse LSECtin, and knockout mice lacking this receptor, to model the biological properties of the human receptor. PMID: 21257728
Liver sinusoidal endothelial cell lectin, LSECtin, negatively regulates hepatic T-cell immune response. PMID: 19632227

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.

Database Links

KEGG: mmu:75863

STRING: 10090.ENSMUSP00000059574

UniGene: Mm.109183

Code	CSB-EP803912MO
Abbreviation	Recombinant Mouse Clec4g protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage